KEGG   Cryptosporidium parvum: cgd5_4560Help
Entry
cgd5_4560         CDS       T00168                                 

Definition
(RefSeq) tryptophan synthase trpB of possible bacterial origin
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cpv  Cryptosporidium parvum
Pathway
cpv00260  Glycine, serine and threonine metabolism
cpv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpv01100  Metabolic pathways
cpv01110  Biosynthesis of secondary metabolites
cpv01130  Biosynthesis of antibiotics
cpv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cgd5_4560
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    cgd5_4560
Enzymes [BR:cpv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     cgd5_4560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 3372307
NCBI-ProteinID: XP_625304
ApiDB_CryptoDB: cgd5_4560
UniProt: Q5CPD7
Position
5
AA seq 443 aa AA seqDB search
KYFNLFLYFFYFILFYLFHFIFEEKKTIETIFFSYFKIMTDNTYLNNFPDSNGYFGKYGG
KYVPEVINNAMKEIEDAYNKISKSEDFINELKKIRKEFQGRPTPIYYAKNLTKKYGGAEI
YLKREDLNHTGAHKLNHCMGEALLAKYMGKKKLIAETGAGQHGVALATAAAYFGLECEIH
MGEVDVKKEYPNVIRMKILGAKVVCVEFGDKTLKEAVDSAFEAYIKDIDNTFYAIGSVVG
PHPFPKMVRDFQSIVGIESREQFLEMNGDGILPDIVTACVGGGSNAMGIFSGFISDKQVE
LICVEPLGKGNKIGEHAASITYGSEGIMHGFNSIMLKDEEGNPSKVHSIASGLDYPSVGP
EIAYLNSIGRTKTVCITDQEAINGFFELSRTEGIIPAIESSHAIGYVLKIAKEMKGKKIL
INLSGRGDKDLDFVVQNYGYGNN
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
aaatattttaatctatttctatatttcttttattttattttattttatttatttcatttt
atttttgaagaaaaaaaaacaattgaaactatttttttttcttattttaaaataatgaca
gataatacttatttaaataatttcccagattcaaatggttattttggtaaatatggtgga
aaatatgtacctgaagtaattaataatgcaatgaaagaaatagaagatgcttataataaa
ataagtaaaagtgaagattttattaatgaattaaaaaaaataagaaaagaatttcaagga
agaccaacaccaatatattatgcaaaaaatttgacaaaaaaatatggtggtgcagaaata
tatttaaaaagagaagatttaaatcatactggtgcacataaattaaatcattgtatggga
gaagcattattagcaaaatatatgggtaaaaaaaaattaatagcagaaacaggagcagga
caacatggtgtagcattagcaacagcagcagcatattttggtttagaatgtgaaatacat
atgggagaagtagatgtaaaaaaagaatatccaaatgtaattagaatgaaaatattaggt
gcaaaagtagtatgtgtagaatttggtgataaaacattaaaagaagcagtagattcagca
tttgaagcatatataaaagatatagataatacattttatgcaataggttcagtagtagga
ccacatccatttccaaaaatggtacgtgattttcaatcaattgtaggtatagaatcaaga
gaacaatttttagaaatgaatggtgatggtatattaccagatattgttacagcatgtgta
ggtggtggtagtaatgcaatgggtatatttagtggttttatatcagataaacaagtagaa
ttaatttgtgttgaaccattaggtaaaggaaataaaataggtgaacatgcagcaagtata
acatatggtagtgaaggaataatgcatggatttaattcaataatgttaaaagatgaagaa
ggaaatccatcaaaagtacatagtatagcaagtggtttagattatccaagtgtaggtcca
gaaattgcatatttaaatagtattggtcgtacaaaaactgtttgtattacagatcaagaa
gcaattaatggattttttgaattaagtagaacagagggtataataccagcaatagaatca
agtcatgcaattggatatgtattaaaaatagcaaaagaaatgaaaggaaagaaaatttta
ataaatttgagtggtagaggagataaagatttagattttgttgtacaaaattatggatat
ggtaataattaa

DBGET integrated database retrieval system