KEGG   Cryptosporidium parvum: cgd7_4080Help
Entry
cgd7_4080         CDS       T00168                                 

Definition
(RefSeq) protein disulfide isomerase, signal peptide, ER retention motif
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cpv  Cryptosporidium parvum
Pathway
cpv04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    cgd7_4080
Enzymes [BR:cpv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     cgd7_4080
Chaperones and folding catalysts [BR:cpv03110]
 Protein folding catalysts
  Protein disulfide isomerase
   cgd7_4080
Membrane trafficking [BR:cpv04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    cgd7_4080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 OST3_OST6 Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 AhpC-TSA Thioredoxin_3 TraF Thioredoxin_4 Redoxin
Motif
Other DBs
NCBI-GeneID: 3371943
NCBI-ProteinID: XP_628564
ApiDB_CryptoDB: cgd7_4080
UniProt: Q5CY16
Position
7
AA seq 451 aa AA seqDB search
IFFTEDFLESFSIRLKVNTLQMRNLLKLILTLSFAPLFVTCLYDSSSQVKVINGSQLKKL
VKENPVVIVEFFAEWCGHCKAFAPEYEKAAKALKGIVPVVAIDDQSDMAEYGIQGFPTVK
VFTEHSVKPKDFTGPRRAESVLNAALSALKDVTNSRLSGKNSGNKGSNKTKESSKKSRKS
RVVELTDSNFDDLVINDNENSWFVKFYAPWCGHCKSLAPDWEELGSMADGRVKIAKLDAT
QHTMMAHRYKIQGFPTLLMFPAGEKREITPVNYNGPRTANDLFEFAIKFQSSSASIKQMI
SQEVFENTCTKGLCVIAFLPHIADSSDSEREKYLKIYKDVVSASAAMTIRFLWSEGGSQF
DFEEKLNLAFGYPAVVAINNEKQRFSTHRGSFTVESLNSFIIALTTGRAPVDPLPKLPKI
SKVSSWEPKKSKENSNAEENRNKSNRQSDEL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
attttcttcacagaagactttttagaaagcttttcaatcagattgaaggtgaatacactg
caaatgaggaatcttctgaaactcatcttaacgctttcctttgctcctctatttgtgaca
tgcttatatgatagtagctcacaggtaaaagttattaatggctcacaacttaagaagtta
gttaaagaaaatcccgttgttatagtagaattttttgcagaatggtgtggacattgcaag
gcgtttgctccagaatatgaaaaagcagcaaaagctctcaaaggcatcgtccctgttgta
gctatagatgatcagagtgatatggctgaatatggtattcagggattcccaacagtgaaa
gtattcacagagcactccgtgaaaccaaaagatttcactggacctagaagagccgagtct
gttttaaacgctgctctttcagcacttaaagatgtaacaaactcgcgtctaagtggtaaa
aattcgggtaataagggatcaaacaagactaaggaatccagtaaaaagtcaagaaagtcc
agagttgttgagcttactgatagtaactttgacgatctagtaattaatgataatgagaat
tcttggttcgttaagttctatgcaccttggtgtgggcattgcaaaagccttgcccctgat
tgggaggagcttggaagtatggcagatggaagggtcaaaatcgccaagctggatgcaact
caacacacaatgatggctcatagatataaaattcaaggatttcccactttgttaatgttc
cctgcaggagaaaagagagaaattactccagttaattacaacgggcccagaacagctaat
gacctttttgaatttgcaataaaattccagtctagctctgcaagcatcaaacagatgatc
agccaggaagtttttgagaacacatgcacaaagggattgtgtgtaattgcattcctacct
cacatagcagactccagcgattctgagagagaaaaatacttaaagatatataaggatgtt
gtttcagcctcagctgcaatgacaattcggttcctttggtcagaggggggatctcagttc
gatttcgaagaaaagctgaacctcgcattcggatatcctgcagttgttgcaattaataac
gagaaacagagattttcaacacatagagggagcttcacagtagaatctcttaattcattt
attattgcattgaccacgggacgcgcccccgtggatcccttacccaagctaccaaagatt
tccaaagtaagttcctgggaaccaaagaaatcgaaagaaaattcaaatgctgaagagaat
agaaataaatcaaatcgtcagtctgacgaactataa

DBGET integrated database retrieval system