KEGG   Cryptosporidium parvum: cgd8_2090
Entry
cgd8_2090         CDS       T00168                                 

Definition
(RefSeq) cation-transporting ATpase 2 with 8 transmembrane domains
  KO
K13526  cation-transporting P-type ATPase 13A2 [EC:7.2.2.-]
Organism
cpv  Cryptosporidium parvum
Brite
KEGG Orthology (KO) [BR:cpv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    cgd8_2090
SSDB
Motif
Pfam: E1-E2_ATPase P5-ATPase Hydrolase Cation_ATPase DUF3060 Hydrolase_3
Other DBs
NCBI-GeneID: 3374500
NCBI-ProteinID: XP_627113
ApiDB_CryptoDB: cgd8_2090
UniProt: Q5CW06
Position
8
AA seq 1491 aa
MQSKVNVSTKEYVTFGGINNCIVYSVISQNNNVESKFHEDSHKFDYPVYITPICRRLYLE
KVYLIFQIFTLGIISIICHWFPNFYRWMNFKASTISECDSFLVITKESYYSVVNRNKFFS
LNKNFSNDELNLLRFLNILPSQYKFSDLKGQKNSNNNISNSHRTSIINCNNTQICHINSQ
LFIPSIEITFFTFCGSIYVFDSVLNKFIITIPSLDNNPYSVIRNRFGKLVGSFLNNENTD
DSNNMDSIEYIQEDSIRQNLQKIFGKCSCDIPIVPIAYLIKNEILHPFFIFQVCAVCIWF
KNSYVEYAIFIILITIVSLINSIYETRCSHIKMNEISKLEYKVSIISRNPTSREPYERTI
NSSDLLPGDLIILKPGMVLPCDAIILTSNVIVNEAALTGESVPVLKSPIPKYSSELFDFE
KDNKHIAYSRTVIMGVQGANNVQGVGLVIRIGFSTLQGRFLQTMYCDVITNRLHYQNDKL
YQDSMRFVKFCFFIGIIGSIITASIGFTIGIEPIIIILRSFDLFTIVAPPALPATIAAGS
TVAVRKLKNKKVSCSNPSSVNIAGQVNTVVFDKTGTLTTDGLDAVGCISSVPGSIPYLDG
LCTSGSQATHLLSQALATCHTVSYIDNEHTHSFGSQYKNENNTAEQSLNSRVIVGEPLEM
CMFEFSGWVLCDDYNRNHIQCMNENYECNAECLNSNNNGKNFKPDRSCSKSSISDSTPNQ
INKNTVKDSLSAQVNNNSCSNFEIDISFMNPENFDLSELPPPRTVRRYFERGEGTHMFGS
QEFEELEILKVYEFCSKLRRMTVVCRNPIKPYEFLVFCKGSPEQLKSICQPESIPSNLDE
CIINYSRCGMRILGFAVGHINCPNEDPTSFLETLSRNEAEERLNFIGLMVFANKLRPSTI
DVISTLKDANINCIMSTGDHIFTSVAVAQECGIFSSYSSIGGGQSNKKIVIGDIIGSQSG
EECIRWTMMNCNYKNIKVFNSIQEILEKYSLENINWVITGQCLRLLHKLHNTFELEYLDL
SNDPERPPNHNNHTFSFFNYNKKAERFYRQIRNNHQSLPCWMTLRSNTRESSSNRLERII
IDTDDGEEFIKSDYVPYHLDCTRHQRKSNIILESSIGVANELEKLMILNFVTMVNDIPLT
LRISALEFIIRYCHVYSRMTPEDKAMHINLLQKLKPDPMVGMCGDGNNDILAIQSANIGI
AIADHEASVAASFVSNERNIAAVPDIIVEGRAALTSTIQSFQFFVLYIFIQFTSVLYLYS
KGTNFTDHQFIWNDVVTFLPISVLATLTKSAKRFPSEIPAYKDILSSNVIIGIVSQCVIQ
LTFLIINIMVVSKQPGFTPYLSGRSYADNNENAGLQMCVENTVTFLVSCIQYVATGIAIH
KTKPFRLSLFTNKLFVIQIFFIIISTIAITLVPTSLLSKFLNIVALPGSSNYILIISFTL
NIVISIFTMNYIIKAVYLKELHSNGPTYFPHFHPLRMPKSKLEWKINPNFI
NT seq 4476 nt   +upstreamnt  +downstreamnt
atgcaaagtaaagttaacgtatcaacaaaagaatatgtcacttttggtggaattaataat
tgtatagtatattcagtaatttctcagaataacaatgtagaaagtaaattccacgaagat
tcacataaatttgattatcctgtatacattactccaatttgtcgtagactttatcttgaa
aaagtttacttgatatttcaaatatttacacttgggataatttcaattatttgccattgg
tttccaaacttttacagatggatgaactttaaagcttcaacaattagtgaatgtgactct
tttttagtcattacaaaagaatcatattattctgttgttaatagaaataagttctttagt
ttaaataagaacttttcaaatgatgaattaaatcttttaagatttcttaatattcttcca
tcacaatataaatttagtgatttaaaaggacaaaagaatagtaacaataatatatcaaat
agccaccgtacaagtattataaattgcaataatactcagatttgccatataaattctcaa
ttatttattccatcaattgaaataacattttttacattctgtggttcaatttatgttttt
gattcagtattaaacaaatttattattacaattccttcacttgataacaatccatattca
gtgattagaaatagatttggaaaacttgttggatcttttctaaataatgaaaatacagat
gactcaaacaatatggactcgattgaatatattcaagaagattcaataaggcaaaatctt
cagaaaatctttggtaaatgttcctgcgatattcctattgttccaattgcataccttatt
aagaatgaaattttacatcctttcttcatatttcaagtatgtgctgtatgtatttggttc
aaaaatagttatgttgaatatgccattttcattatattaattacaatagtttcattaatt
aattcaatatatgaaacaagatgcagtcatattaagatgaatgaaatatcaaaacttgaa
tataaagtttcaataatatcaagaaatccaacatctagagaaccatatgaacgaacaatt
aactcttcagatcttcttcctggtgatctaattatattaaaacctgggatggtacttcca
tgtgacgcaataatattgacttcaaacgttattgtaaatgaagcagctctaactggagaa
tctgttcctgttctgaaatcaccaatacctaaatattccagtgaactttttgattttgaa
aaagataataaacatattgcttactctagaacagttataatgggagttcaaggagcaaac
aatgtccaaggagttggtcttgtaatcagaattggattttcaactcttcaaggtagattt
cttcaaacaatgtattgtgatgtaataaccaataggctacattatcagaacgataaactt
tatcaagattcgatgagatttgttaaattctgcttctttattggaataattgggtcaatt
attactgcttctataggatttaccattggcatagaaccaataattatcatacttcgctct
tttgatttattcacaattgttgctccaccagctctacctgctactattgctgcaggttca
actgtagcagtaaggaaacttaagaataagaaggtttcttgctctaatccaagttctgta
aatattgcaggtcaagtaaatactgtagtttttgataaaactggaactcttaccactgat
ggattagacgccgtaggatgtatatcgtcagtacctggttcaataccttatctagatgga
ttatgtacatcaggatcccaagcaacgcatcttttatctcaagctcttgcaacttgtcat
actgtgagttatatagataatgaacacacacacagttttggtagtcaatataagaacgaa
aataatactgcagagcagtcgctaaattcgagagtaattgttggcgaacctttagaaatg
tgcatgttcgagtttagtggatgggtattatgtgatgattataatcgaaaccatattcaa
tgtatgaatgagaattatgagtgcaacgctgaatgtctgaatagcaataataatggtaag
aactttaaacctgatagatcatgttcaaaatcttcaatttctgactctactccaaatcaa
atcaataagaatactgtgaaagattctttatctgcgcaagtaaacaataattcatgtagc
aactttgaaattgatatcagctttatgaaccctgaaaactttgatctttctgaacttcca
cctccaagaactgttagaagatactttgaacgtggggaaggaactcatatgtttggatca
caagaatttgaagaacttgagattcttaaggtatatgaattttgctcaaagctacgaaga
atgactgtagtttgtagaaaccctattaaaccttatgaatttttggttttttgtaaaggt
agtcctgaacaattaaaatcaatttgccagccggaatctattccttcgaatttagatgaa
tgcatcattaactattcaagatgtggaatgcgtattcttgggtttgctgttggtcatatt
aactgtccaaacgaagatcctacatctttcttagaaactttatcgagaaatgaagcagag
gaaagacttaacttcattggtttaatggtatttgcaaataaacttcgtccaagtaccatt
gatgttatttcaactcttaaagatgccaatattaattgtataatgtcaactggggaccat
atttttacttctgtagcagttgctcaagaatgtggaatattctcatcttatagttcaatt
ggaggagggcaatctaataaaaagattgtaattggtgatattattggatctcaatctgga
gaagaatgtataagatggacaatgatgaattgtaattacaagaacatcaaagtttttaat
agtattcaagaaatattggagaaatattcacttgaaaatattaattgggtaatcacagga
caatgtttaaggttacttcataaacttcacaatacgtttgaacttgaatatttagactta
tccaatgatcctgaaagacctccaaatcataataaccacactttctctttctttaattac
aataaaaaagctgagagattttatagacaaataagaaacaatcatcaaagtctaccatgt
tggatgactttaagatccaatacacgtgagtctagctcaaatcgtcttgaacgtataatt
attgatactgacgacggagaagagtttattaaatctgattacgttccataccatcttgac
tgcaccagacatcaaaggaaatctaatataattttggagagctcaattggagttgctaat
gaacttgagaaattaatgattcttaattttgttacaatggtgaacgatatccccttaaca
ttacgtatatcagctttggaattcattattagatactgtcatgtatattcaagaatgaca
cctgaagataaagccatgcacattaacttacttcaaaagcttaagccagatccaatggtt
ggtatgtgtggtgacggaaataatgatattcttgcaatacaatctgccaatattggaata
gccatagctgatcacgaggcttctgttgctgcctcatttgtttcaaatgaaagaaacatt
gcagcagttccagacattattgttgagggtagagctgccctaacatcaacaattcaatca
ttccagttctttgtattatatatcttcatccaatttacatcagtactgtacttatatagt
aagggtacaaacttcacagaccatcaatttatttggaacgatgttgttactttcctccca
atttctgtattggctacattaactaaaagcgctaaacgttttccatcagaaatacctgct
tataaagatattctaagcagcaatgttatcattggaattgtttctcaatgtgtgattcaa
ctgaccttccttattataaacattatggtagtttccaaacagccaggatttacaccatat
ttatctggaagaagttatgctgataacaacgagaatgctggccttcaaatgtgtgttgaa
aacactgtaacctttcttgtttcctgtattcaatatgtggcaactggaattgcaatccac
aaaactaaaccattcagactctcgctatttacaaacaagcttttcgttatccaaatattt
tttatcataatttcgactattgcaatcactttggtaccaacctctttactttccaaattc
cttaacattgtcgcccttccgggttcttcaaattatattttaatcatttcatttaccttg
aatattgtcattagcatattcactatgaactacattattaaagcagtatacctaaaagaa
ttgcacagtaatggtccaacttatttccctcactttcatcctcttcgaatgccaaagagc
aaactagaatggaaaattaatccgaactttatttaa

DBGET integrated database retrieval system