KEGG   Cryptosporidium parvum: cgd8_3460Help
Entry
cgd8_3460         CDS       T00168                                 

Definition
(RefSeq) methionyl-tRNA synthetase of possible bacterial origin
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cpv  Cryptosporidium parvum
Pathway
cpv00450  Selenocompound metabolism
cpv00970  Aminoacyl-tRNA biosynthesis
cpv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    cgd8_3460
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    cgd8_3460
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpv01007]
    cgd8_3460
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cpv03016]
    cgd8_3460
Enzymes [BR:cpv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     cgd8_3460
Amino acid related enzymes [BR:cpv01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   cgd8_3460
Transfer RNA biogenesis [BR:cpv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    cgd8_3460
 Prokaryotic type
   Other AARSs
    cgd8_3460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 3374619
NCBI-ProteinID: XP_627239
ApiDB_CryptoDB: cgd8_3460
UniProt: Q5CVN0
Position
8
AA seq 581 aa AA seqDB search
KRSFRVYSDYCRNNLTYNKMTKINTTYRNSSGKYYYFTTAINYTNGTPHMGHAYEIVTSD
ILVRIARLFGFNTRFQTGTDEHGQKIAATAEKKGISPKELCDENVKQFKNMNEKLQISTD
RFIRTTDADHYESCKELWRRCEAKGDIYLGKYNGWYNVREESFMTELEAKMLNYTDPISG
LPLTKMEEPSYFFRITNYLESIKNHIIDNPEFIQPESSRESILARLEALGSDSEDLSISR
ASFSWGVPVPNDQEHVMYVWFDALTNYITGLKWADFDNDLEENSLFNKYWENTVHIVGKD
ITWFHSVIWPAMLLSVGLSLPKTIFAHGFVTAPDGKKMSKSLGNVVDPFEQIDKIGSDPF
RYYLAREGRFGNDIKYQPSSVIDYNNGELADTYGNLISRITNLTHKFCQGVAPSLSQSLL
LDKPVDIDTVFEEYYLAWNCFRIDECIQIAMDLSRNINKFLTDHAPWNKDNGKSDEERIE
IIRIVLEGSYYISILLSPFITLACKEVFNRLGTPEKIIPEVDINYNNIKPGTPILIGEPL
FKRIVNKEEKTFEELKAEKREREKQRRSGNKKLSETKDKGK
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
aaacgaagttttcgagtttattcagattattgtagaaataatttaacttacaataaaatg
actaagataaatacaacatacagaaactcgtcgggaaaatattactacttcacgactgca
ataaactatactaatggaacaccgcatatggggcacgcatatgaaatagtaacttctgat
attcttgttagaattgcaaggctattcggctttaatacaagatttcaaacaggaactgat
gaacatgggcaaaaaattgcagctactgcagaaaaaaaaggcatatctccaaaagaactt
tgcgatgaaaatgtaaaacaatttaaaaatatgaatgaaaaacttcagattagtacggac
aggtttattagaacaactgatgctgatcattatgaatcatgtaaggagttatggagacgt
tgtgaggcgaaaggagacatttaccttggaaagtataatggatggtataacgtaagagaa
gagagttttatgactgaattagaagcaaaaatgctaaattatactgacccaatttcggga
ttacctttaacaaagatggaagaaccttcttactttttcagaataactaattatcttgaa
tcaataaaaaaccacattattgacaatccagaatttatacagccggaatcgagtagagaa
agtatattagcaaggttagaggctcttggcagcgattctgaggacttatctataagtaga
gctagtttttcctggggagttcccgttccaaatgaccaggaacatgttatgtatgtttgg
tttgatgctctaacaaattatattactggtttgaaatgggctgattttgacaatgatctt
gaagaaaattcgttatttaacaagtattgggaaaatacagttcatatcgttggtaaagac
attacttggttccattccgtaatctggcctgcgatgctattaagtgtcggactcagcttg
ccaaaaacgatttttgctcatggatttgttaccgcacccgacggtaaaaaaatgagtaag
agcttggggaatgttgttgatccattcgaacaaattgataaaattggttctgatccattt
agatattacttggctagagaagggagatttgggaatgatattaaatatcaaccttcttcc
gttatagactataataatggtgaattagctgatacttatgggaatcttatttcaagaatt
acaaatttaacacacaaattttgccagggagttgcgccttctttatctcaatctttgtta
ttagataaaccagtagatattgatacagttttcgaagaatactatttggcttggaattgt
ttccgtattgatgagtgcatacaaatagcaatggatttgtcgaggaatattaataagttc
cttactgaccacgcaccttggaacaaagataatggcaagtctgatgaagagaggatagaa
attattagaatcgtattggaaggttcctactatatttcaattctgcttagtccatttatt
actttggcatgtaaggaggttttcaatagacttgggactccagagaaaataatcccagaa
gttgatataaactataataacattaaacctggcacgccaatattgattggcgaacctcta
tttaagagaattgtgaataaggaagaaaagacattcgaagagcttaaagcagagaaaaga
gaaagagagaaacaaagaagatcaggaaataagaaattaagtgaaactaaagataaggga
aaatag

DBGET integrated database retrieval system