KEGG   Coccidioides posadasii: CPC735_004240Help
Entry
CPC735_004240     CDS       T01332                                 

Definition
(RefSeq) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4, putative
  KO
K09579  peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 [EC:5.2.1.8]
Organism
cpw  Coccidioides posadasii
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cpw03110]
    CPC735_004240
Enzymes [BR:cpw01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     CPC735_004240
Chaperones and folding catalysts [BR:cpw03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    CPC735_004240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rotamase_3 Rotamase Rotamase_2
Motif
Other DBs
NCBI-GeneID: 9693881
NCBI-ProteinID: XP_003068398
UniProt: C5P941
Position
Unknown
AA seq 126 aa AA seqDB search
MAPKNKGKGKGKAKDSSESGDVGGKGKGLKPANSINVRHILCEKHSKKEEALAKLRAGAK
FDEVAREFSEDKARQGGSLGWKIRGSLDAAFEKAAYDLEPSTTASPKYAEVKTGFGYHII
MVEGRK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaaaaacaaaggcaaaggcaaaggcaaagcaaaagacagctcagaaagcggc
gatgttggcggcaagggtaaaggcctcaagcccgccaactccatcaacgtccgccacatt
ctttgcgaaaaacactctaagaaagaagaagctctcgcaaagctgagagcgggcgccaag
ttcgacgaagtcgcgagagaattctctgaagacaaagctcgacaaggcggatctctaggc
tggaagatcagaggcagtctcgacgccgcgtttgagaaggccgcatatgacctggagccc
agcacgacagctagtcccaaatatgcagaggtaaaaacgggctttggctatcacattatc
atggtagaaggcaggaagtga

DBGET integrated database retrieval system