KEGG   Coccidioides posadasii: CPC735_005980Help
Entry
CPC735_005980     CDS       T01332                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00220  Arginine biosynthesis
cpw00330  Arginine and proline metabolism
cpw01100  Metabolic pathways
cpw01110  Biosynthesis of secondary metabolites
cpw01130  Biosynthesis of antibiotics
cpw01230  Biosynthesis of amino acids
Module
cpw_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CPC735_005980
   00330 Arginine and proline metabolism
    CPC735_005980
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CPC735_005980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 9694054
NCBI-ProteinID: XP_003068571
UniProt: P40906
Position
Unknown
AA seq 322 aa AA seqDB search
MTSPSTIKQKFIAKGHQLGVVAVGFSDGQPNQGVDPSGLIEAGLLDQLRDDLEYDIRHDG
QVHTYAEFVPEHDPNHRGMKKPRTVSAATQQLSRQVYEHAREGRLVLTLGGDHSIAIGTI
SGTAKAIRERLGREMAVIWVDAHADINRPEDSDSGNIHGMPLAFLTGLAKDDNEDMFGWL
QPDNLISPRKLVYIGLRDVDRAEKRLLREHGIKAFSMHDIDKYGIGRVVEMALAHIGQDT
PIHLSFDVDALDPQWAPSTGTPVRGGLTLREGDFIAESIHETGSLVAMDLVEVNPTLETL
GASETIRAGCSLVRSALGDTLL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacatctccaagcaccattaagcagaaattcatagcaaagggacaccagctcggcgtc
gtggccgttggtttctcggatggccagcccaaccaaggcgtcgatccctccggcctcatc
gaagccggacttcttgaccagctccgcgatgatctagaatacgacattcgccatgacggc
caggtacacacatacgccgaattcgtgcctgaacacgatccgaaccaccggggcatgaaa
aagcctcgaaccgtgagtgccgccacccaacagctaagcaggcaggtctacgagcacgca
cgcgagggcagactagtgcttaccctcggcggagaccactccatcgccatcggtaccatc
tctggaaccgcgaaggcgatccgggaacggttgggacgcgagatggctgtgatctgggtg
gatgcacatgcggatattaacaggccagaggacagcgacagtgggaacatccacggcatg
cctcttgcgtttttgaccggattggcaaaggatgacaacgaagatatgtttggctggttg
cagccggataatctgatcagccctaggaaattggtatatatcggactaagagatgtggat
cgcgcagagaagagactgctgagggagcatggtatcaaggcctttagcatgcatgacatc
gacaagtatggtattggccgtgtggtggagatggcccttgcgcatattggtcaagatacg
cccatccatctctcctttgacgtggatgctcttgacccacagtgggctcccagcaccgga
actcccgtccgaggaggtttgacgctccgtgaaggtgactttattgccgaatccatccac
gaaaccggcagtctagtggcgatggacttggtagaggtcaacccaaccctcgagacattg
ggagcgagcgagacaatccgtgctggatgctcgttggttcgaagtgcactgggagacacc
cttctgtag

DBGET integrated database retrieval system