KEGG   Coccidioides posadasii: CPC735_012310Help
Entry
CPC735_012310     CDS       T01332                                 

Definition
(RefSeq) Malate synthase, glyoxysomal, putative
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00620  Pyruvate metabolism
cpw00630  Glyoxylate and dicarboxylate metabolism
cpw01100  Metabolic pathways
cpw01110  Biosynthesis of secondary metabolites
cpw01200  Carbon metabolism
Module
cpw_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CPC735_012310
   00630 Glyoxylate and dicarboxylate metabolism
    CPC735_012310
Enzymes [BR:cpw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CPC735_012310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-GeneID: 9697553
NCBI-ProteinID: XP_003072058
UniProt: C5NZM0
Position
Unknown
AA seq 539 aa AA seqDB search
MTSVDAQLKDVAILGQISEPARKILTRDACAFLALLHRTFNGTRKALLQRRIARQAELDR
GQLLDFLPETKHIRENDAWKGAPPAPGLVDRRVEITGPTDRKMVVNALNSDVWTYMADFE
DSSAPTWENMVNGQVNLYDAIRRQIDFTQGGKEYKLRTDRKLPTLIARARGWHLDEKHFT
VDGEPISGGLFDFGLYFFHNAHELVKRGAGPYFYLPKMESHLEARLWNDVFNLAQDYIGM
PRGTIRGTVLIETISAAFEMDEIIYELREHSSGLNCGRWDYIFSFIKKFRQNPNFVLPDR
SAVTMTVPFMDAYVRLLIKTCHRRGVHAMGGMAAQIPIKNDPKANDAAMESVRADKLREV
RAGHDGTWVAHPALASIASDIFNKYMPTPNQLFVRREDVHVTANDLLNTNVPGSITEEGI
RKNINIGLSYMEGWLRGVGCIPINSLMEDAATAEVSRSQLWQWARHNVVTAEGKRVDKAY
NLKLLKEQADELASKGPKGNKYQLAARYFASQVTGEDYADFLTSLLYNEISAPGSAAKL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgacttccgttgacgctcagctcaaggatgtcgccatcctcggccagatcagcgaaccc
gcacgtaagatcctcaccagagacgcatgcgccttcctagccttgcttcaccgcacattc
aatggaacgagaaaagcacttcttcagcgacgcattgcccgccaggctgaactcgacaga
ggccagcttctagacttcctccctgagaccaagcacatccgtgaaaacgatgcgtggaaa
ggtgctcctcctgcaccgggattggtcgatcgccgcgttgagattacgggtccgacggac
cggaagatggtggttaatgcgctgaattcggatgtatggacgtatatggctgattttgaa
gattcgagcgctccaacatgggaaaacatggtcaatggccaggttaacctttatgatgct
atccgtcgtcagatcgacttcacccagggaggaaaggaatataaactccgcaccgacaga
aaattgcccacacttatcgcccgtgctagaggttggcatttggatgagaagcatttcacc
gtcgatggcgagcctatctccggtggtttgttcgatttcggtctttacttcttccacaat
gcccacgagttggtgaagagaggcgctggcccatacttctatcttccaaagatggaatcc
cacttggaagcccgcctatggaatgatgttttcaacttggcacaggactatattggcatg
ccgagaggcaccatccgtggaactgtccttattgagacgatctctgctgccttcgagatg
gacgagatcatctatgaactccgagagcacagttcaggtctgaactgcggaagatgggac
tacatcttctcgttcatcaagaaattccgccagaatcccaactttgtcctccccgaccgt
tctgctgttaccatgactgtgccgttcatggatgcctatgtcaggcttttgatcaagacc
tgccacagacgaggtgtccacgcgatgggtggtatggctgctcaaatccccatcaagaat
gatcccaaggccaacgacgctgccatggagagcgttcgcgccgacaagctccgtgaggtg
cgcgctggtcatgacggcacatgggttgctcacccagcccttgcatccattgcttccgac
atcttcaacaagtacatgccaactcccaaccaactcttcgtccgaagggaggatgtacat
gttactgccaatgatctcctaaataccaacgtccccggtagcatcactgaggaaggaatc
agaaagaacatcaacattggcctttcatacatggagggatggctccgtggtgttggatgt
atcccaatcaacagtctgatggaggatgccgccaccgctgaagtcagccgaagccagctc
tggcagtgggcccgccacaacgttgttactgctgagggcaagagggtcgacaaggcttac
aacttgaaactcctgaaggagcaagccgacgagctcgcctccaagggtcccaagggcaac
aaataccagcttgccgctcgctacttcgccagccaggttactggagaagattatgcagat
ttcttgacctcgttgttgtacaatgagatctctgctcctggaagtgcagctaagctgtaa

DBGET integrated database retrieval system