KEGG   Coccidioides posadasii: CPC735_017620Help
Entry
CPC735_017620     CDS       T01332                                 

Definition
(RefSeq) Longevity-assurance family protein
  KO
K04709  Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00600  Sphingolipid metabolism
cpw01100  Metabolic pathways
Module
cpw_M00094  Ceramide biosynthesis
cpw_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CPC735_017620
Enzymes [BR:cpw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     CPC735_017620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Motif
Other DBs
NCBI-GeneID: 9692776
NCBI-ProteinID: XP_003067305
UniProt: C5PDJ9
Position
Unknown
AA seq 442 aa AA seqDB search
MALAASDPPGLYKGRPPRSFSETNVAPHSKRRRARSVFRCWENFCLKHTWVIPLVLLTVI
LSAYAVNPNDSNPIHQLIFLSYPLPPETPDGPVMYGKGPADMAFVVFYTIVLSFTREFLM
QRMIKPLARRCGIKGKAKTSRFMEQFYTAVYFAIFGPYGLYVMSRTKIWYFNTTAMFEGF
PHKTHTADFKAYYLLEASYWAQQAIVLVLQLEKPRKDFKELVGHHIVTLALIALSYRFHF
TYIGLAVYITHDVSDFFLATSKTLNYLDSAIMGPYFAMFIAIWIYMRHYLNLRIIWAVLT
EFRTVGPFELNWETQQYKCWISQYITFALLSALQAINLFWLFLILRIAKRYLLNNIKQDE
RSDNEEEEEEVEDTPHNDKTNNGSTTVPTILLNGNSPTSVRRRNADKENEVSNGVTNGRA
TGSTAHSHAESSTPTMNGKKQK
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggctctcgccgcttcggatccccctgggttgtacaagggtcgacctccgcgatcattt
tctgaaacaaatgtcgctccccactcgaagcggcgtcgtgcgcgctcggtgtttcgctgc
tgggagaacttctgcctcaagcacacatgggtcatacctctcgtcctgttaacagttatc
ctctccgcctacgctgtgaatccaaatgattccaatcccatacaccagctcatcttcctc
tcctatccacttcctcctgaaacacccgatggaccggtgatgtatgggaagggccctgcc
gacatggcctttgtggtgttttacacaatcgtgctctccttcacacgtgaatttttgatg
cagaggatgatcaaaccgctggcgcgtcgctgtggaataaaggggaaggcgaaaacctcc
cgtttcatggaacagttctacaccgctgtttactttgccatcttcgggccctacggtcta
tatgtcatgagtcgcacgaagatatggtacttcaatacgacggcgatgttcgaaggcttc
ccccacaagacgcacactgccgatttcaaggcgtattacttgcttgaggcaagctactgg
gcccagcaggccatcgttttggtcttgcagctggagaaacctaggaaggatttcaaagag
cttgtgggacatcacatcgtcacactggcgttgattgcgctcagctatcgtttccatttc
acttatatcggcctggctgtctatattacacatgatgtgtcggacttcttccttgcgact
tccaaaacactaaattatttggattctgcaatcatgggcccttactttgcgatgtttatt
gccatctggatttacatgagacattacctgaatctccgcattatctgggctgtcttaacg
gaatttcgaactgtcgggcccttcgagctcaattgggaaacacagcaatacaaatgctgg
atcagtcagtatattacatttgcacttttgagcgcgctgcaggccataaacttgttctgg
ctcttccttatccttcgaatcgcaaagcgatatcttctcaacaacatcaaacaggatgaa
cggagcgataatgaagaggaagaggaggaagtcgaagatacacctcacaacgacaaaact
aataatggttcaacaaccgtcccgacgatattacttaacggaaacagcccgacatcagtt
aggagaagaaatgctgataaggagaatgaagtttctaacggtgttaccaatggccgtgcg
actggctctacggcacattcacatgctgaatcctcgacacccaccatgaatggcaagaag
caaaaatga

DBGET integrated database retrieval system