KEGG   Coccidioides posadasii: CPC735_018190
Entry
CPC735_018190     CDS       T01332                                 

Definition
(RefSeq) hypothetical protein
Organism
cpw  Coccidioides posadasii
SSDB
Motif
Pfam: RsfS
Other DBs
NCBI-GeneID: 9692971
NCBI-ProteinID: XP_003067360
UniProt: C5PDQ4
Position
Unknown
AA seq 725 aa
MHRLMLRGIQCYGCRSHVIQSFLAIADITFPAPRYHKPCPRSPLHHQSSFSSLHGQPFRG
QSIARSASSGEPSVDNGSEQSPDAASQSNEHVPWYLKEETAELASHPLGQQQLIPPLPDN
PPPMLEDLLQHISVDIGLDDLSLLDLRNRNPPPALGANLIMIIGTARSVKHLNVAADRLC
RWLRSTYKLQPTADGLLGRNELKIKLRRKARRAKLSSNVSSSFEEKDDGITTGWICVNVG
SVENGKPAAGAQKRDFAGFGNVADSARIVVQMLTEEKRAELDLEGLWNGNFPPRSPSELR
AFEQQFEQFAEKAAAEATSGRGMYRDSRSHATGSGIDPGQRRGLHTSRRVQSISIEAVLS
PGMVPRQEAALNHEDHLVSPRNAPAKASKPLNVPPEITSLLQHLAQLPRDDALRELGSGP
RDMGSTLFLRLFQQALDNAEDPDGNILAKLELIRIAVTLQHPQYTKADLFDAFKELAASG
YDISESQALQTVKTLLSFGDNDADVSNVAKRVLRSDIDLALKVLNHMSLRGMDILSREVF
SMLYTASGFQVPVRPTNDNLSPSSVETEKSTPVSAEELNEVRLVQDRLRKIMDAFDVKFG
PEQFLSLLRFHFHHGNYDQFWAIWRKMSLLQLPRSKEFYVLLFRLHAERGNQKRAAECLS
SWVPMMAREQPPVHLDADIARVVMACLLVANPDVKQRADAGDPGEYPNLWNRCWNALVAS
QTVQE
NT seq 2178 nt   +upstreamnt  +downstreamnt
atgcaccgcctcatgcttcgaggcatccagtgctacggctgtcgcagccatgtcatccag
tcttttctggccatcgctgatatcacttttcccgcgcctcgataccacaaaccatgccct
cgatctccgttacaccaccagagcagcttttcatcattacacggtcagccctttcggggc
cagtccatagcccgcagcgcatcttctggcgagccgtccgtcgacaacggtagcgagcaa
tctccagacgctgccagtcaatccaacgaacatgtgccgtggtatctcaaggaagagact
gcggagctcgcttctcacccgcttgggcaacagcagttgatcccaccgctgccagacaac
cctcccccaatgctggaagatcttctgcagcacatctcggttgacattggtctcgatgat
ctctctctcctcgatctgcgaaatcgcaatcctcctcctgctcttggcgcaaacctgatc
atgatcatcgggaccgctcgcagtgtaaagcatctcaatgtcgctgcggatcgactgtgt
cgttggttaaggagtacttacaaattgcaaccgaccgcagacggccttttgggtcgaaac
gaattgaagatcaaactgcgaagaaaggcccgccgggcgaagctatctagcaacgtgtca
tcttcttttgaggaaaaagacgatgggatcacaactgggtggatatgtgtgaacgttggt
tctgttgagaacgggaaaccggccgcgggagcacaaaagcgcgattttgccgggttcgga
aacgtcgcggatagtgctcgaatcgtggtacagatgctcactgaagaaaagagagccgag
ctcgacttagaaggcctgtggaatggcaactttccaccgcgatctccaagcgaactgcgg
gctttcgagcaacaattcgaacaattcgctgaaaaggcggctgcagaggcaacaagtgga
agaggcatgtatcgcgactcgagatcacatgcaacgggttctggcatagaccccggacaa
agaagaggtttgcataccagccgtcgcgtccaaagcatcagtatcgaggccgttctttca
cccgggatggtacctcggcaagaagcggcgttgaaccatgaagatcatttggtctctcct
cgcaatgcgccagcaaaggcttcaaaacctctcaatgtgcctcctgagatcacatcattg
cttcagcatttggctcagcttcccagggatgatgcactccgggaattgggatcaggtccc
cgagatatgggctccacattatttttgcgtctgttccagcaggccttggacaacgcagag
gatccggacggtaatattcttgcgaaattggagctgatccgtatcgccgtcactctacag
catcctcagtatacaaaagcggatttattcgatgctttcaaggagctggctgcttcagga
tatgacatctctgagtctcaagcactgcagacggtcaaaacactgctctcttttggcgac
aacgatgccgatgtctctaatgtcgcgaaacgcgtcctgcgatctgatatagatctggca
ctcaaggttctcaaccatatgagcttgcgtggtatggacattcttagtcgcgaggtcttc
tccatgctctacaccgcgtccggattccaagttccggtccgcccaaccaacgataaccta
agtcccagttccgttgaaacagaaaagtccactccggtgtcggcggaagagcttaacgaa
gtgcgccttgttcaggatcgtcttcgcaaaatcatggatgccttcgatgttaagtttgga
cctgagcagtttctgagcctcctccgatttcacttccaccatggaaattatgaccaattc
tgggctatctggcggaagatgtcacttttgcaacttccccgatcaaaggagttttatgtg
ctactattccgcctccatgccgagagagggaaccaaaagagagcggccgagtgcctgtcg
tcatgggttcctatgatggcacgggagcagccacctgtccaccttgacgccgacattgca
agagtggtgatggcatgtttactggtggccaatccggatgtcaagcagagggcggacgca
ggcgaccccggcgagtatcccaacctgtggaacagatgctggaatgccctggtggcgagt
caaacggtccaggaataa

DBGET integrated database retrieval system