KEGG   Coccidioides posadasii: CPC735_019790Help
Entry
CPC735_019790     CDS       T01332                                 

Definition
(RefSeq) Mannitol dehydrogenase family protein
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00051  Fructose and mannose metabolism
cpw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CPC735_019790
Enzymes [BR:cpw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     CPC735_019790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh
Motif
Other DBs
NCBI-GeneID: 9690719
NCBI-ProteinID: XP_003065096
UniProt: C5PJ02
Position
Unknown
AA seq 412 aa AA seqDB search
MGKKAVHFGGGNIGRGFVGEFLHESDYEVVFVDVMDSIIDALQGASSYKVTEVSNEGEHT
KTVTNYRAINSKHNLDQVISEISTADVVTCAVGPNILKFIAPPIAKGIDARTIERPLAVV
ACENAIGATDTLHKFVKENTDPSRVESLSSRARFANSAIDRIVPTQDPNSGLDVKIEKFY
EWVVEKTPFGEWGHPDIQAILWVDNLDPYIERKLYTVNTGHATAAYYGYNMGKKTIYESM
SDEKIRGHVRDALSETSTLIVDKYGIPAEEQRKYVDAIVARISNPHLEDVVERVGRAPLR
KLGRKERFVGPASQLAERGKKVDALLGAMEQALRFQNVPEDDESFELAKILKTESAEDAT
AKLTGLESDHPLFARVVERVAKVQKGPNVMISICRRLVSLYSAAYESLMKSR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagaaggctgtccactttggaggcggcaacatcggccgtggcttcgttggcgaa
ttcctccacgagtctgactatgaagtcgtcttcgttgatgtgatggactccatcatcgac
gcgctccaaggcgcttcctcatacaaggtcaccgaggttagcaacgagggagagcacacc
aagaccgtcaccaactaccgtgctatcaattccaagcataatctcgaccaggtcatcagc
gagatctctaccgctgatgtcgtcacctgcgccgtcggcccaaacatcctcaagtttatt
gcgcctccaatcgccaagggcatcgacgcccgtactatcgaaagacctcttgccgtcgtg
gcctgtgagaacgccattggcgctaccgataccctccacaaatttgtcaaagaaaacact
gacccttctcgcgtcgagtccctttcttctcgagctcgattcgccaactccgccatcgac
cgtatcgtccccactcaagacccaaattcgggcctcgacgtgaagatcgaaaagttctac
gaatgggtggtggaaaagacaccatttggggaatggggacaccccgatatccaggctatt
ctctgggtcgacaatctggatccttacattgaacgtaagctttacactgtcaacaccgga
catgctactgccgcatactacgggtacaacatgggcaagaagactatctacgagtctatg
agcgacgagaagatccgtggccatgtcagagacgctctctctgagacttcgacccttatt
gttgataagtatggcattccagccgaggagcagcgcaagtacgtcgacgccatcgtcgcc
cgaatttctaacccacacctcgaggacgtagtcgagcgtgtcggccgtgccccacttcgc
aaactcggtcgcaaggaacgctttgtcggccctgcctctcagttggccgagcgcggaaag
aaagtcgatgccttgttgggggctatggaacaggctctgcgattccagaatgttcccgag
gacgacgagagcttcgagcttgccaagatcctgaagacagaatctgcagaggatgcaacc
gcgaagctgactgggttggaaagcgaccatccacttttcgcacgcgttgttgaacgtgtt
gcgaaggttcagaaaggaccgaatgtgatgatttcaatttgcaggcgcctcgtttcactg
tactctgctgcttatgagtctctgatgaaatcacgatag

DBGET integrated database retrieval system