KEGG   Coccidioides posadasii: CPC735_020980Help
Entry
CPC735_020980     CDS       T01332                                 

Definition
(RefSeq) FK506-binding protein 2 precursor/ peptidyl-prolyl cis-trans isomerase, putative
  KO
K09569  FK506-binding protein 2 [EC:5.2.1.8]
Organism
cpw  Coccidioides posadasii
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cpw03110]
    CPC735_020980
Enzymes [BR:cpw01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     CPC735_020980
Chaperones and folding catalysts [BR:cpw03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    CPC735_020980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 9690684
NCBI-ProteinID: XP_003065215
UniProt: C5PJC1
Position
Unknown
AA seq 144 aa AA seqDB search
MHLPSLFSVLSVSLSLSSLVAATTTEELPNGLKIEKIHTVDCERRTLSGDSIKVHYRGTL
AESGKQFDASYDRGSPLSFMVGTGMVIQGWDQGLIGMCVGDKRKLTIPPELGYGNRAMGP
IPAGSTLIFETELMEIEGVKKDEL
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcccgtccctcttttcggtcctctctgtctcgctctccctctcctctcttgtt
gctgcgactaccaccgaggagctccccaatgggctgaaaattgaaaagatacacaccgtg
gattgtgagcgacgcaccctcagcggcgactccattaaggtgcattaccgcggcaccctt
gcggagagcggcaaacaattcgatgctagctatgatcgcgggtctccgttgagctttatg
gtgggaacaggcatggttattcagggctgggaccagggccttatcggcatgtgcgttggg
gacaagagaaagttaactattcctccggagctggggtacggaaatcgggccatgggaccg
attccggctggatcgacgcttatttttgagactgagttgatggagattgagggtgtaaaa
aaggatgaactttga

DBGET integrated database retrieval system