KEGG   Coccidioides posadasii: CPC735_033080Help
Entry
CPC735_033080     CDS       T01332                                 

Definition
(RefSeq) succinyl-CoA synthetase beta chain, putative
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00020  Citrate cycle (TCA cycle)
cpw00640  Propanoate metabolism
cpw01100  Metabolic pathways
cpw01110  Biosynthesis of secondary metabolites
cpw01130  Biosynthesis of antibiotics
cpw01200  Carbon metabolism
Module
cpw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cpw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPC735_033080
   00640 Propanoate metabolism
    CPC735_033080
Enzymes [BR:cpw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     CPC735_033080
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CPC735_033080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA CoA_binding Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 9695612
NCBI-ProteinID: XP_003070117
UniProt: C5P5I2
Position
Unknown
AA seq 712 aa AA seqDB search
MAGVPRFNAIRPSCLHLTPTNRYHSRFVTAKNSNAGFSTTSRLQSYEDTLKNLKIGADTK
VLFQGFTGTHTYLFLYKEIYPKPNKKMATANVKESLQWGTKIVGGVKPGVEGEHLGLPVF
PSVRVAQEKARPDATAVYVPGNQTAAAIEEAIEAEIPLVVAVAEHVPIHDILRIHSILRT
QSKTRLVGANCPGIISAIGKCRIGFQPLPCFSSGHVGIVAKSGTLSYETVASTTRAGLGQ
SLCIGMGGDVLAGTDFVDALKVFEHDDDTHGIIIVGEIGGTAEMDAAEWIKDYRRRTANP
KPIMGLVGGIEAPHGRIMGHAGAWTAPGEPDAQMKIKALQDAGAVIVDHPEKFGEGMKTL
LGNSAKRPVFEDFTPRIARQQRGVHTLRRPQILRSSSISAQRRSLYLQQSDSFVLLKERN
IPVRESNEPGAFFLGASIDRTAHSPSFIASPTIDAKRYIESAKIFPFEYGKREFSANSAE
IQAIAAHVGLAEPVQKSLSTLLEALTDIFMTKEAFSLETKVAVSSAGVLEVQGARFGFDD
AAYRSAKRQEDIHKLRNKELEVPEEVEAEKDGIVYVRLEGEGTIGTLVNGAGLAMNTVDA
LTIRGGHCANFLDTGGKATSETVKSAFKIILSDPRVKAIFVNIFGGLTRSEMIAEGIIMA
FRDLGMKVPVVVRLRGTNEELGQKMIAESKLPLHAFDSFKEAAAKVISLSHS
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggctggggttcctcggttcaacgccattagaccctcttgtttgcatctgacacctaca
aatcgctaccattctcggtttgttacggcaaagaactcgaatgcaggcttttctactact
tcaaggcttcagagttatgaagatacgttgaaaaatcttaaaatcggcgctgacacaaag
gtattattccaaggattcactggtacgcatacctacctcttcctttataaagaaatatat
ccaaaaccaaataaaaagatggcaactgccaatgtgaaagaatcattgcaatgggggaca
aagattgtaggaggagttaagcccggagttgaaggcgagcatctaggactgcctgtattc
ccgtctgttcgagtggcacaggaaaaagcgagaccggatgcgaccgcggtttacgtgcct
ggcaatcaaacagcggcggccattgaggaggcgatagaagctgaaatacccctggtggtc
gcagtcgcagaacacgtaccgatccatgacatactcaggattcactccatacttcgaacg
caatcgaaaactcgactcgttggtgcgaattgcccgggtattatttccgccattggaaag
tgtcgcatcgggttccagccactgccctgtttctcgtccggccatgtgggcatcgttgcc
aagtcagggactctcagttatgagaccgtggcctcaacaacgcgggctggtttaggccag
agcctttgcattgggatgggcggcgacgtgctcgcgggaacagattttgtggatgcactc
aaggtctttgaacatgacgatgatacgcatggtataataatcgttggagaaatcggcggt
actgctgaaatggatgctgcggaatggatcaaagattatcgtagaaggactgcaaatccc
aagcccattatgggtttggttggaggcatcgaagctcctcatggccgaatcatgggccac
gcgggcgcatggacggcaccaggggagcctgatgcacaaatgaaaatcaaagcgttgcag
gatgccggggctgtaattgtagaccaccccgagaaattcggggagggcatgaaaaccttg
ctgggcaactctgctaagcgaccagtatttgaagattttaccccgaggatagcccgacag
cagcgaggcgtccatacgttaagacgaccccaaattctccgcagtagtagtatttccgcg
cagcgccgaagtctttatcttcaacaatccgactcctttgttcttctcaaggaaaggaac
attcctgttcgtgaatcaaacgaaccgggtgcctttttcctgggcgcttcaattgaccgc
actgcacattccccaagttttattgcttctcctaccatagacgcaaaaagatatatcgaa
tctgcgaagatatttccatttgagtatgggaagagagaattctccgctaatagcgctgaa
attcaggcaatagctgcccatgtcgggcttgctgaacctgtccaaaaatcgctatcgacg
ctgctggaagcgttaacggatatatttatgaccaaggaagctttctcactggaaacgaaa
gttgctgtttccagtgctggcgttttggaagtccaaggagcgcgatttgggtttgatgat
gctgcatatagaagtgcaaagaggcaagaggatatccataaattgaggaacaaggaacta
gaagttccagaagaagtggaggccgagaaggatggaattgtttatgttaggcttgaaggc
gaaggaacaattggtactctcgtgaatggagctggacttgctatgaacaccgtcgatgcc
ctcaccattcgtggtggacactgtgcaaacttcctcgatacaggcggcaaagccacctca
gagacagtaaagtcggcgtttaaaattattctctcagacccgcgagtcaaagccattttt
gtgaacatattcggcggcttaactaggtctgagatgatcgccgagggcataatcatggcc
ttccgagatttgggtatgaaagtgcctgtcgtcgtccggttgcgtgggacgaatgaggaa
cttggtcagaaaatgattgccgaaagtaaacttccgctccatgcttttgattccttcaag
gaagccgcggcgaaagtgatcagcctttcgcactcgtaa

DBGET integrated database retrieval system