KEGG   Coccidioides posadasii: CPC735_033480Help
Entry
CPC735_033480     CDS       T01332                                 

Definition
(RefSeq) beta-glucosidase 4
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00500  Starch and sucrose metabolism
cpw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CPC735_033480
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     CPC735_033480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_17
Motif
Other DBs
NCBI-GeneID: 9695652
NCBI-ProteinID: XP_003070157
UniProt: C5P5M2
Position
Unknown
AA seq 306 aa AA seqDB search
MRLSTLLPLALAAVPAVSAAGKLGFALGVKNADGSCKSQADFEKDFDVLKAHSNIVRTYA
AADCNNAEAIVPAAKKKGFNLVLGVWPDVPESFDADTKALQKVIPGNEDVITAITVGSET
LYRGNFTGQELLQKINQVQKMFPKVKVGTADSWNKYADGTADPIIAGGVKYLLVNAFAFW
QGQDISNATDTYIDDMMQAMVHIQKVAGANAKQIHIATGETGWPSDGGSDFGAAKAGTKN
AKTFFEKGVCAMLSWGVDVFYFEAFDEPWKPKSIGDNGKAADETHWGLYTADRRSKYTPV
CKHIRS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgtcgactctccttcctctcgccctggcggccgtacccgctgtctctgcggcc
ggcaagcttggctttgctctcggtgttaagaatgccgatggttcctgcaaatcccaggca
gactttgagaaggatttcgatgttttgaaggcccactcaaatatcgtccggacatacgcc
gcggccgattgcaacaatgctgaggccattgttccagctgctaagaagaagggatttaat
cttgtcttgggtgtctggcctgatgtcccggagtccttcgacgcagacaccaaagctttg
cagaaagtaatcccaggaaatgaagatgtgatcaccgctataaccgtcggctctgagact
ttgtaccgtggcaacttcaccggccaagagcttttgcagaagatcaaccaggttcagaag
atgttccccaaggttaaggtcggcactgcagacagttggaacaagtatgccgatggtact
gctgatccaatcatcgcgggtggtgtcaagtatctactcgtcaacgctttcgcattctgg
caaggacaggacatttccaatgccaccgacacatacatcgatgacatgatgcaggccatg
gttcacatccagaaagtcgctggagcgaatgctaagcaaattcacattgctactggagag
accggttggccaagtgacggtggaagcgacttcggtgctgccaaagctggaactaaaaat
gctaagaccttctttgagaaaggcgtgtgtgcaatgctttcctggggcgtcgacgtcttc
tacttcgaggctttcgatgagccatggaagccaaagagcattggcgacaatggcaaggct
gctgacgagactcactggggcttgtacaccgctgatcgccggtccaagtacacgcctgtg
tgcaaacatattcgatcttga

DBGET integrated database retrieval system