KEGG   Coccidioides posadasii: CPC735_035050Help
Entry
CPC735_035050     CDS       T01332                                 

Definition
(RefSeq) methionyl-tRNA synthetase, putative
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00450  Selenocompound metabolism
cpw00970  Aminoacyl-tRNA biosynthesis
cpw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CPC735_035050
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CPC735_035050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpw01007]
    CPC735_035050
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cpw03016]
    CPC735_035050
Enzymes [BR:cpw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CPC735_035050
Amino acid related enzymes [BR:cpw01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CPC735_035050
Transfer RNA biogenesis [BR:cpw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CPC735_035050
 Prokaryotic type
   Other AARSs
    CPC735_035050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 RNA_polI_A34 PepSY
Motif
Other DBs
NCBI-GeneID: 9695809
NCBI-ProteinID: XP_003070314
UniProt: C5P629
Position
Unknown
AA seq 657 aa AA seqDB search
MGSQEKILPQKGQRNILVTSALPYVNNVPHLGNIVGSVLSADVFARYHKACGRPTLYVCG
TDEYGTATETKALEEGVTPEELCAKYNKIHQEVYEWFEIGFDFFGRTPTQKHTEISQSIF
KRLYKNGYLEEKTAEQPFCEKHQSFLADRYVEGECPRCHYDDARGDQCDKCGSLLDPFDL
INPRCKVDGATPVSRPTKHIHLLLDKLQPQIEDWVRPAIEKGDWPKNSRVITESWLKEGL
KDRGITRDLKWGVPVPLEGYDNKVLYVWFEACIGYPSITANYTDDWELWWRNPEDVRLYQ
FLGKDNVPFHAVIFPGCQLGTKDNWTMLHHLSTTEYLNYENGKFSKSRGIGVFGNNAKDT
GIPPDVWRYYLLKNRPETGDTQFEWRSFIDANNGELLAKLGNLVNRVVKLIASPKAYSSV
VPDFTIPESFNPILDDVTAILRQYIEEMEGVHLRAGLITAMRVAEAGNNLIQSNKLDNSL
IANEPERAATVVGIVTNLIHLCASVFSPYLPATSKSILEQLNAPFKNIPSLEDLKDGWKP
TAIKAGHKIGKAKYLFSNIDVKKADEWREMFGGSQAERRKKEEEAAKVAAKKAANKAKKK
EKKKQPKGDKEDVRVGKSVETSAKGGAEAVSATAEDKKGEAVEKITDGVAQVTIPTS
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgggctcccaagagaaaatcctgccccagaagggccaacggaatattctcgttaccagc
gccttgccttacgtaaataacgttccccatctcggaaacattgtgggctccgttcttagt
gccgatgtctttgctagatatcacaaagcctgtggcagaccgactctatacgtctgcgga
accgacgaatatggcacggcgacggaaaccaaggcgctcgaagaaggtgtgacgcccgag
gagctatgcgccaaatacaacaaaattcaccaggaagtttatgaatggttcgagatcggg
tttgactttttcggccggactccaacgcaaaagcataccgaaatatcgcagagcattttt
aagcgactctacaagaatggatacctggaggagaagaccgcggaacagccattttgcgaa
aagcaccaatcctttttagcagaccgatatgtggagggcgaatgcccccggtgccactac
gatgatgccagaggagaccagtgcgataaatgcggctctctcctggatcctttcgatttg
attaatccccgttgtaaggtcgacggcgcgacaccagttagccgtccaacgaaacatatt
catcttctattggataaacttcagccgcagattgaagattgggttcgccctgctatagag
aaaggagactggccgaaaaacagtcgagtcattactgaatcatggctgaaggagggcctc
aaagatcgtggcattacgcgagatttaaaatggggtgtaccggttcctctcgaaggctat
gacaacaaagttctttacgtctggttcgaggcttgtattggatatccttccataacggcc
aactacaccgatgattgggagctctggtggagaaatccagaggacgtccgattataccag
ttcctcggaaaagataatgtacccttccacgctgtcatttttcccggctgccagttagga
acaaaggacaattggaccatgttgcaccaccttagcaccaccgaatatcttaactatgag
aacggcaagttcagcaaatcccgcggtatcggtgtctttggaaacaatgccaaggacact
ggcattcccccagatgtgtggagatactaccttctcaagaaccgaccagaaactggcgat
acccaatttgaatggcgttccttcatcgatgccaacaatggagagcttcttgcgaaactg
ggaaacctcgtaaatcgagttgtcaaactgatagcgagtcccaaagcttacagcagcgtt
gtgcctgattttaccattccggaatcattcaaccccattctagatgatgtaacagccatt
ctccgccagtacattgaagaaatggaaggggttcaccttcgtgctgggctcatcaccgct
atgagggtcgctgaagccggcaacaacctcattcaatcaaacaaactcgacaattctctc
attgccaacgagccagaacgggctgccaccgtggtcggcatagtgactaacttaattcac
ctttgtgccagcgtcttctctccgtacctccccgcaacatcaaagtccattctcgaacaa
ctaaatgctccattcaaaaatatcccatccctagaagacctcaaggacggttggaagccc
actgccatcaaggctggccataagattggcaaagcaaagtatctcttctctaacatcgac
gtcaagaaggctgatgaatggcgggaaatgtttggtggttcccaggccgaaaggcgaaag
aaggaggaagaagctgccaaagtggctgccaaaaaggccgcaaacaaggctaaaaagaag
gagaagaagaagcagcccaagggagataaagaggatgtacgcgtgggaaagagtgtggag
acctctgcaaagggaggtgcagaagctgtttctgcaacagcagaagacaagaagggtgaa
gcggtggagaagattactgatggcgttgcccaggtcacgattcccacatcttaa

DBGET integrated database retrieval system