KEGG   Coccidioides posadasii: CPC735_038000
Entry
CPC735_038000     CDS       T01332                                 

Definition
(RefSeq) C-14 sterol reductase, putative
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00100  Steroid biosynthesis
cpw01100  Metabolic pathways
cpw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    CPC735_038000
Enzymes [BR:cpw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     CPC735_038000
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 9696734
NCBI-ProteinID: XP_003071239
UniProt: C5P2J1
Position
Unknown
AA seq 480 aa
MARQKPKYEFGGPPGATAIVLGLPVLMNFLYFTCNDVTGCPAPALLDIRTLTWESLKSQI
PWPRDGILGFASWKATKWTLAYYLLSLVLYRVLPAQEVYGTKLRESGRPLKYRFNAFYAT
IVQLAACAVGTYLYGANFVVWTFITDNYLQILTANIIIAYVLSVYVYIGSFGVKPGNSEM
RELARGGHTGNMIYDFYIGRELNPRITLPFIGEVDLKAWFEMRPGLTGWALLNLAFVAKQ
YRTYGYVTDSIFIITAVQGYYVLEGQYAETGILGMMDITTDGLGFMLSFGDIVWVPFLYS
TQCRYLSVYPVQLGWMGLVAVSTVFAIGLYIFRAANGQKNTFRTNPNHPSVAGMSYIQTK
RGTRLLTAGWWGVARHINYFGDWTQSLPFSLPTAFAGYLIFPANSHVADVGVTKMLDGRE
VIQGAARGWGTLYTYFYAVWFATMLIHRERRDDAACAEKYGDDWDKYKKVVKWRIVPGIY
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggccagacagaaacccaagtatgaattcgggggccctccaggggccactgctatcgtc
cttggccttccagtgctgatgaattttctctatttcacctgcaatgatgtgaccggctgt
ccagcaccagctcttctagatatccgcactcttacctgggaaagcttaaagtcgcaaatc
ccgtggccacgggatggcatcttgggtttcgcgagctggaaagctacaaagtggacgcta
gcttattatctgctcagcttggtcctgtatcgggtgcttccggctcaggaggtatacggg
accaaattgcgcgagtctggccgtccgcttaaataccgcttcaatgctttctatgccacc
attgtccaattggccgcatgcgcggtcggcacctacctctatggtgcgaacttcgtcgtt
tggacattcatcaccgacaactacttgcaaattctgaccgctaatatcatcatcgcctat
gtcctttcggtgtacgtctacattggtagttttggtgtgaaacctggtaacagcgagatg
cgagaacttgccaggggaggccacactggaaatatgatctacgatttttacattggacgt
gaactaaatccccgaatcacgctccccttcattggcgaagttgatctcaaggcctggttc
gagatgcgtcccggtctgaccggttgggcgttactcaacctagccttcgttgctaagcaa
taccgtacgtacggctacgtaaccgacagcatctttatcataacggcggtgcagggctat
tacgtactcgagggtcagtatgcggaaacaggcattctgggcatgatggacatcaccacg
gacggactaggatttatgctcagtttcggggatatcgtttgggtgccgttcttgtactcg
acccagtgtcgctatctctcagtctacccggtacaactggggtggatgggactcgtcgca
gttagtactgtgttcgccatcggcctgtatatcttccgcgccgccaacggccagaaaaac
acctttcgcactaatcccaatcaccctagcgtcgcgggcatgtcgtacatacaaacaaag
agaggcacaaggctactcactgccggatggtggggagtcgcacggcatattaattacttt
ggggactggacgcagtcattgccttttagtctcccgacagcttttgcgggctacctcatt
tttccagccaatagccacgttgcagatgtgggtgtcactaagatgctcgatggccgggag
gtgatccagggcgccgcacgagggtggggcactctttatacgtatttctacgctgtgtgg
tttgccactatgctcattcatcgtgaacggagagacgatgccgcctgtgcagagaagtat
ggcgatgactgggacaagtacaaaaaggttgtgaaatggagaatcgttcccggcatctat
tag

DBGET integrated database retrieval system