KEGG   Coccidioides posadasii: CPC735_047100Help
Entry
CPC735_047100     CDS       T01332                                 

Definition
(RefSeq) succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial precursor, putative
  KO
K01027  3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00072  Synthesis and degradation of ketone bodies
cpw00280  Valine, leucine and isoleucine degradation
cpw00650  Butanoate metabolism
cpw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CPC735_047100
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    CPC735_047100
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CPC735_047100
Enzymes [BR:cpw01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     CPC735_047100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-GeneID: 9690955
NCBI-ProteinID: XP_003065485
UniProt: C5PFN7
Position
Unknown
AA seq 520 aa AA seqDB search
MQLRKSITCLRLARQFSANPTRHQKFLIRAFSSTFARNEINKVVSSAEEAIKDMKSNSTL
LAGGFGLCGVPDSLINAVHKNPEITGLTAVSNNAGVDGAGLGLLLASGQIKKMIASYVGE
NKTFERMYLSGQIDLELTPQGTLAERCRAGGAGIPAFYTPAAFGTVVQTGELPLRNNPDG
TVALYGQPRDVKVFDGKSYVMEESIKGDYAFVKAWKADKLGNCQFRYAAQNFNGAMGRNA
KMTIVEAENIVEVGEIEPASVHLPGIYVKRVVQSTTEKKIEKYTFAKEGNEADMSALGKG
DTASKRERIVRRAAKEFKNGMYANLGIGMPMLAPNFVDPSVEVQLQSENGILGLGPYPKK
GQEDADLINAGKETVTLLPGASCFGSDESFGMIRSGRIELTMLGAMQVSAKGDLANWMLP
GKIKGFGGAMDLVSNPSKTRVVVTMEHTDKKGNPKILKQCEFPLTGRACVSRIITDLCVF
DVDFTNGLTLIELADGVTVDEVRAKTEAPFKVADDVKPML
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcagttacggaagtccatcacctgcttgcgccttgcaaggcagttctctgcaaacccc
actagacatcaaaaattccttatccgcgcattctccagcacctttgcccgaaatgagatc
aacaaggttgtgtcgtcggccgaggaggccatcaaggatatgaaatccaactccacactc
ttggctggtggtttcggtctttgtggcgtgccagacagcttgatcaatgccgttcacaag
aatcccgagatcacaggcctcacggctgtcagtaacaatgctggtgtcgacggtgccggt
cttggtcttctcttggccagcggacagatcaagaagatgattgctagttatgttggcgag
aacaagacctttgaacgcatgtatctctctggacagatcgatctggaattgactccccag
ggtaccttggccgaacgatgccgtgcaggtggtgctggtatcccagccttctacacccca
gctgcctttggaactgttgtccagaccggtgagcttcctctcagaaacaaccctgacggc
acagttgctctgtacggccaacccagagacgtcaaggtatttgacggcaagagctacgtc
atggaggagtcgatcaagggtgactatgcctttgttaaggcctggaaggccgacaagctc
ggtaactgtcagttccgctatgctgcccagaacttcaacggcgcgatgggtcgtaatgcc
aagatgaccattgtcgaggccgaaaacatcgttgaggtcggcgagatcgagcccgcttcg
gttcacctgcccggaatctacgtcaagcgtgtcgtccagagcaccaccgagaagaagatc
gagaaatacacattcgctaaggagggtaacgaggctgatatgtctgctctcggcaagggc
gataccgccagcaagagagaacgcatcgtccgccgtgccgccaaggagttcaagaacgga
atgtatgccaacttgggtattggcatgccgatgttggctcccaacttcgttgacccatcc
gtcgaggttcagctgcagtcggagaacgggatcctcggtcttggaccctaccctaagaag
ggccaggaggacgccgatttgatcaatgccggcaaggaaaccgtcacattgctccccggt
gcatcctgcttcggcagtgatgagtcctttggcatgatccgatctggacgcattgagttg
actatgttgggtgctatgcaagttagcgcaaagggtgacctcgccaactggatgttgccc
ggcaagatcaagggcttcggcggcgccatggatctcgtctctaacccctccaagaccagg
gtcgtggtcaccatggagcacaccgataagaagggaaaccccaagattctcaagcagtgc
gagttccctcttactggtcgtgcttgtgttagcagaatcatcaccgacctttgcgtcttc
gatgtcgatttcaccaatggcttgactttgatcgagcttgccgacggtgtcactgtcgat
gaagtccgcgccaagacggaggcaccgttcaaggttgcggatgatgtgaagccgatgctc
tga

DBGET integrated database retrieval system