KEGG   Coccidioides posadasii: CPC735_048470Help
Entry
CPC735_048470     CDS       T01332                                 

Definition
(RefSeq) anthranilate phosphoribosyltransferase family protein
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpw01100  Metabolic pathways
cpw01110  Biosynthesis of secondary metabolites
cpw01130  Biosynthesis of antibiotics
cpw01230  Biosynthesis of amino acids
Module
cpw_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CPC735_048470
Enzymes [BR:cpw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     CPC735_048470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N
Motif
Other DBs
NCBI-GeneID: 9691092
NCBI-ProteinID: XP_003065622
UniProt: C5PG24
Position
Unknown
AA seq 438 aa AA seqDB search
MAAESPTSKPEPVSISPLLQRLAYPDTSEIQVSAGEIASAFALIFEDRLSVIQTAALLTL
LHSTGLDRDSDVIAQCANRMREAAEQTERGPLRKVLRERGRKEGAYQGGLCDIVGTGGDQ
HSTFNISTTSSIIASPLLMMAKHGNRAQTSFSGSADVLNSIAPRPPKISAVNSSNIAQVL
AETNYAFLFAPNFHPGMMYANPVRRGLGLRTIFNLMGPLANPVEWALEARVVGVAYQSLG
PVFADALRISGAKKALIICGEEDLDEISCAGKTNCWRLSEYPNPEYKGSESTETEDDDDD
DDDDHDHEAPPRTIVKLDTFQIQPSDFGLPVHPLSDVGGGKPPRENALKLMSILRNELPR
DDPILDFVLMNVAALIVTSGVCEADTSNMGPGDDGNVIKERGPGGLRWKEGVRRARWAIE
SGEALKCLEKFIDVTNRL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagaaagccccacaagcaagccggagccagtgtccatttcaccactgcttcag
aggctcgcctaccccgacacctcagagatccaggtatcagctggagaaattgcttcagca
tttgcattgatctttgaagaccgtctctcagttatacagacagctgccctactcacttta
ctacattcgactggattggacagagactcggacgtaattgcgcaatgtgccaatcgtatg
cgcgaagctgccgaacagaccgagagggggccattgaggaaagtcctacgagagaggggt
cgaaaggagggtgcgtatcaaggtggattgtgtgacattgtcggtaccggtggcgaccaa
cattcgaccttcaatatctctacgacctcgtccatcatagcctcgccattgcttatgatg
gctaagcatggcaaccgggcacagacttctttctccggttcggccgacgtcttaaattca
atcgcacctaggccacctaagatatccgccgtaaactcgagtaatattgcgcaggtcctt
gccgaaaccaactacgcatttctctttgcacccaacttccatcccggtatgatgtatgcc
aacccggtccgacgaggcctgggactccgaacgatatttaatctaatggggccgcttgcc
aaccctgtggaatgggccctggaagctcgggtagtaggtgtcgcttatcaaagtttggga
ccggtgttcgccgatgcgcttcgaataagcggagctaagaaggcactgataatctgcggc
gaagaagatctagacgaaatcagttgtgcagggaagacgaactgctggaggctttccgaa
tacccgaatcctgaatacaagggaagcgagagcacagagaccgaggatgacgacgatgac
gatgacgatgatcatgatcatgaggcgccacccagaactatagttaagctggatacgttc
caaattcagccgtcggactttggattgccagtccatccactgtcagatgtgggcggtggc
aagccgccacgcgaaaatgccctgaagctgatgagcatcttacggaacgaactcccccgc
gatgatccaatattggactttgttctcatgaatgtggcagcattgatcgttacttctggc
gtctgcgaagcggacaccagcaatatggggcccggagatgatggaaacgtcatcaaagaa
cgtggccccggcggtctcagatggaaagaaggcgtgagacgtgcgcgctgggccatcgag
agcggagaggccttgaagtgtcttgagaaatttatcgatgtcacgaacaggctttaa

DBGET integrated database retrieval system