KEGG   Coccidioides posadasii: CPC735_052570Help
Entry
CPC735_052570     CDS       T01332                                 

Definition
(RefSeq) thiazole biosynthetic enzyme, mitochondrial precursor, putative
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00730  Thiamine metabolism
cpw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CPC735_052570
Enzymes [BR:cpw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     CPC735_052570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 DAO NAD_binding_8 Lycopene_cycl NAD_binding_9 Pyr_redox_2 FAD_binding_2 FAD_binding_3 Pyr_redox_3 FAD_oxidored Trp_halogenase HI0933_like
Motif
Other DBs
NCBI-GeneID: 9691502
NCBI-ProteinID: XP_003066032
UniProt: C5PH84
Position
Unknown
AA seq 328 aa AA seqDB search
MSTVTETVTLPAHLANKTELVGHPPTVNSKEAGDRALLDEFAGKWDSFKFGPIRESQVSR
AMTRRYFKDLDTYAESDIVIVGAGSCGLSTAYVLAKARPDLKIAIIEAAVSPGGGAWLGG
QLFSAMVLRKPADKFLDEIGVPYEEEPSNPHVVVIKHASLFTSTLLSKVLAFPNIKLFNA
TCVEDLITRPEPAGGLRIAGVVTNWTLVAEHHDDHSCMDPNTINTPLVISTTGHDGPFGA
FCAKRLVSMNAIEKLGGMRGLDMNSAEEAIVKNTREVTKGLIIGGMELSEIDGWHRMGPI
FSAMMLSGVKAAEVALEVFEQRKKECAA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtctactgtcactgaaaccgttaccctgcccgcccatcttgccaacaagaccgaattg
gttggacacccccccactgttaatagcaaggaagcgggtgatcgtgctctcttggacgaa
tttgctgggaaatgggatagttttaagtttggtcccattcgtgagagccaggtctctcgt
gccatgaccaggcgatacttcaaggacctggacacttacgctgagagtgacatcgtcatt
gtcggcgccggttcctgcggccttagcactgcctatgtcctcgccaaggcgcgtcctgac
ctgaaaattgccatcattgaagctgccgtctctcctggcggtggtgcatggctcggcggt
cagctcttctccgccatggtcctccgcaaacctgcggacaaattcctcgacgaaatcggc
gtcccttacgaagaggagccttccaacccgcatgttgtcgtgatcaaacacgcctcgctc
ttcacctccaccttgctctctaaggttcttgcattccccaacatcaagctcttcaacgcc
acctgcgttgaggaccttatcacccgcccagaaccggccggtggcctgcgcatcgccggt
gtggtgaccaactggaccctcgtggctgaacaccatgacgatcactcctgcatggacccc
aacaccatcaatacacctctcgtcatcagcaccaccggccacgatggtccttttggcgcc
ttctgtgccaagcgtctcgtctcgatgaacgccatcgagaaattgggcggtatgcgtggc
ttggatatgaactctgctgaagaggctattgtcaagaatacccgtgaagtcaccaagggt
ttgatcatcggtggaatggaacttagtgagattgacggatggcaccgcatgggccctatc
ttctctgccatgatgctcagcggcgttaaggctgcagaggttgctctggaggtctttgag
cagcgcaagaaagaatgtgcggcttaa

DBGET integrated database retrieval system