KEGG   Coccidioides posadasii: CPC735_055520Help
Entry
CPC735_055520     CDS       T01332                                 

Definition
(RefSeq) ATP-dependent helicase DHX8, putative
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
cpw  Coccidioides posadasii
Pathway
cpw03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CPC735_055520
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cpw03041]
    CPC735_055520
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     CPC735_055520
Spliceosome [BR:cpw03041]
 Complex C
  Other components
   Step II factors
    CPC735_055520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 T2SSE AAA_19 AAA_30 DUF2075 AAA_16
Motif
Other DBs
NCBI-GeneID: 9691797
NCBI-ProteinID: XP_003066327
UniProt: C5PI29
Position
Unknown
AA seq 1225 aa AA seqDB search
MDDLQSLELLSLVSRVTTELQNHLGINDKTLAEFVIDQHLKCGGSFKEFKGSLEGMGAEF
PQSLMESIDRLVLAMHPKYKLKQNATDKHSSERENGNGAKINDIEMKAKVFKALAMPDKA
PQWEDGDYTKPGEISRNDAGADVLDDTFAMLEGLAAKARGKGDGAKSRKRSRSPSSDDYD
RGTRRREKYRSRSRSRSGERRYRRDEDVAHERSGTKYGGRNDRYRDDYKDRRGRRGRDDD
DYFRRPPTPELDERPILYKVYDGRVTGIKDFGAFVNLQGVRGKVDGLVHVSAMQDGARVN
HPSDLVSRAQPVKVKVVSIQGSRIGLSMKEVDQVTGRDLVPQRRIASGANMERLDGTGAD
DRYGNLSSNVHVIEDDDDGKPLRNKRRLNSPERWEIKQLIASGAVSAADYPDIDEEYHAT
LRGEGDFEEEEDVDIEVKDEEPPFLAGQTKQSLELSPIRVVRAPDGSLNRAAMAGTNLAK
ERRELRQQEAQDKAAEQASQVDLNAQWQDPMIAPDQRKFASELRTAQKTDAIPEWKRVTQ
SKDVSYGKRTNLTIKQQRESLPVFKFRKQLLEAVHKNQLLIVVGDTGSGKTTQVTQYLAE
AGFANDGMIGCTQPRRVAAVSVAKRVAEEVGCRLGQEVGYTIRFEDCSSPDTKIKYMTDG
ILQREILLDPDLKKYSVIMLDEAHERTIATDVLFGLLKKTIKRRPDLKLIVTSATLDAEK
FSEYFNGCPIFTIPGRTFPVEIMYSREPETDYLDAALVTVMQIHLTEPEGDILLFLTGQE
EIDTSCEILYERMKSLGPNVPELIILPVYSALPSEMQSRIFDPAPPGSRKVVIATNIAET
SITIDHIYYVIDPGFVKQNAYDPKLGMDSLVVTPISQAQAKQRAGRAGRTGPGKCFRLYT
EAAFQSEMLPTSIPEIQRQNLSHTILMLKAMGINDLLHFDFMDPPPTNTMLTALEELYAL
SALDDEGLLTRLGRKMADFPMEPALAKVLIASVDMGCSDEVLSIVAMLSVQNVFYRPKEK
QQQADQKKSKFHDPHGDHLTLLNVYNAWKNSRYSNPWCFENFIQARQMRRAQDVRQQLVS
IMERYHHKIVSCGRNTIKVRKALCSGFFRNSARKDPQEGYKTLIEGTPVYMHPSSSLFGK
AAEHVIFHTLVLTTKEYMHCTTAIEPKWLVEAAPTFFKVAPTDRLSKRKKAERIQPLHNR
FAGEDDWRLSAQRRQGRGGGGGTWG
NT seq 3678 nt NT seq  +upstreamnt  +downstreamnt
atggacgaccttcagtcgctggagcttctgtctctggtttccagagtgacaaccgagctc
cagaaccatttaggaatcaacgacaagaccctcgccgagttcgtaatcgaccagcatcta
aaatgtggcggatcattcaaggagttcaagggctcactcgagggcatgggggcggaattc
ccgcagagcttgatggagagtatcgatcgcttggtgctggccatgcacccgaagtacaag
ctgaagcagaatgcgacggacaaacactcctccgagcgggaaaacggcaacggtgcgaag
ataaatgatattgagatgaaggcaaaggtgtttaaagcgttggcgatgccggataaggca
ccccaatgggaagatggtgattatacgaagccaggagaaatttcgagaaacgatgccggt
gcagacgtcctagacgatacctttgcgatgcttgaaggtctggccgcgaaagccaggggc
aaaggggatggagctaagagtaggaagcggagcaggagcccaagtagtgatgactatgat
cgaggaacgcggcgccgagaaaagtaccgttccagatctaggtcacgcagcggtgaacgg
cgctacaggcgagacgaagatgtggcccacgaacggtcagggacaaagtatggaggaagg
aatgacagatacagagacgactataaggatcgaagagggcggagaggccgtgatgatgat
gactatttccgcagacctcctacacccgaacttgacgaacggccgatcctttacaaggtg
tacgatggacgagttaccggtataaaggattttggggcctttgtcaatctacagggtgtt
agagggaaggtcgatggacttgttcatgtttctgcaatgcaagatggtgctagggtcaat
catccgtctgatctggtgtcgcgagcacagcccgtcaaagtcaaagtcgtgtctatacaa
gggtcccgtatcggcttgtctatgaaagaagtcgatcaagtgacagggagagatcttgtt
cctcagagacgtatcgcctccggtgcaaatatggaaagactcgatggaactggagctgat
gatcgctatggtaatttaagctccaacgtacatgtaatagaggatgatgacgacgggaag
ccgctaaggaataaaaggcgcttaaactcgcctgaaagatgggagattaagcaactcatt
gcttctggtgccgtttcggctgcagattatcccgatattgacgaagaatatcacgccaca
cttaggggagaaggcgattttgaagaagaggaggatgtggacattgaagttaaggatgaa
gaaccgccatttttagctggacaaaccaagcaatcgctggagttatcacctatccgtgtt
gtcagggcacctgatggctcgctgaaccgagctgcaatggctgggacaaaccttgcaaaa
gaaagaagggaacttcgccaacaggaggcacaggataaggctgcagaacaagcctcccaa
gttgatttaaatgcacaatggcaagaccccatgattgcgccggaccaaagaaaatttgcc
tccgagttgcggaccgcacagaaaacggatgcaattcccgaatggaaacgagttacccaa
agtaaagacgtttcttacggaaagagaacgaacttgacaatcaaacagcaaagagagagt
cttccagttttcaagttccgcaaacaactgctagaggccgtccacaagaatcagctcttg
attgtggtcggtgatactggctcaggaaaaactactcaagtcacccaatatcttgccgaa
gctgggtttgcaaatgatggtatgatcggatgtacgcagcctcgtcgagtcgctgccgtt
tctgttgcgaaacgtgttgcggaagaggttggttgccgactgggccaggaagttggatac
actattcgctttgaggattgctcgagcccagatacaaagatcaaatatatgacagacggc
atccttcagagagagattcttttggatccggacttgaaaaagtactccgttatcatgctt
gacgaagcacacgagagaacaattgctacagatgttctttttgggcttctgaaaaagact
attaaacgaagaccggatttaaagctaattgttacatccgcaaccctcgatgctgagaag
ttctctgaatatttcaacgggtgccccatttttacaataccaggccggacgtttcctgtt
gagatcatgtattctcgcgaaccggaaacagattatctggatgctgcacttgtcacagtg
atgcaaattcacctcacggagccagaaggcgacattttactctttctaactggtcaggaa
gaaattgacacgagctgcgaaattttgtacgagagaatgaaatctcttggcccaaatgtc
ccggaattaattattcttcccgtctattctgctcttcccagcgagatgcagagtaggatc
ttcgatccagcacctccaggaagcaggaaagtggttattgcgacgaatatcgccgaaaca
tccattactatagaccacatttattatgttattgaccctggttttgtgaagcagaacgct
tatgatccaaaattaggcatggactcacttgtcgtgactccaatctctcaggcacaggcc
aagcaacgagcaggtcgtgctggaagaactggccctggtaaatgttttcgtctatacacg
gaggctgcattccagtccgaaatgttaccaacttccatccccgaaattcaacgccaaaac
ctatctcatactatcctgatgctaaaagctatgggaattaatgatttacttcacttcgac
ttcatggacccgccgccaacaaatactatgcttacagctcttgaagaactatacgccctt
tcggcccttgacgacgaaggccttttgacccgacttggcaggaaaatggcagacttcccc
atggaaccagctctcgcaaaagttctcatcgcatcagtcgatatgggttgctccgacgag
gttctaagtatcgtagctatgctttccgtccagaatgttttctatcgtcccaaagaaaaa
cagcaacaggccgaccaaaaaaagtccaaattccacgatccgcatggcgatcaccttact
cttctcaatgtctataacgcctggaaaaattcccggtacagtaacccttggtgctttgaa
aacttcattcaagctcggcaaatgcggcgtgcacaggacgttcgccagcaactagttagt
atcatggagagataccatcataagattgtatcgtgcggaaggaacacgatcaaagttcgc
aaagcgttatgttcgggattcttcaggaattccgcgcgcaaggatccacaagagggctac
aagactctgatcgaaggaacgccggtatacatgcatcccagctcgtcgttgtttgggaag
gcagcggaacacgttattttccatacactggtgctgacaacgaaagaatacatgcattgt
acaactgcgattgagccgaagtggctcgtcgaagcagcaccgacgttcttcaaagtcgct
ccaactgaccgcctgtctaaacggaagaaggcagaacgtatccagccactccataaccgt
tttgctggcgaggatgactggcgattatctgctcaaagacgacagggaagaggtggtggt
ggcggcacttggggttaa

DBGET integrated database retrieval system