KEGG   Coccidioides posadasii: CPC735_056200
Entry
CPC735_056200     CDS       T01332                                 

Definition
(RefSeq) zinc knuckle containing protein
Organism
cpw  Coccidioides posadasii
SSDB
Motif
Pfam: zf-CCHC zf-CCHC_6 zf-C2H2_10 zf-CCHC_2 zinc_ribbon_12 zf-CCHC_4
Other DBs
NCBI-GeneID: 9691865
NCBI-ProteinID: XP_003066395
UniProt: C5PI97
Position
Unknown
AA seq 193 aa
MPEEAWAILKKASDERDLEDFREALKIYSKAVPLATFDEIEKKFRADNFKIYLIGLSATS
PKIALRKVSTAELVAIAGKEEGHMSKECDKPRNMDNVTCRNCEKTGHMSRDCPEEKDWSK
VQCTNCKEMGHTFRRCNKPAEGADSDNADSYGGFYGAGIGSKNHHDQTRGRKETTAQSAG
NWYEEPTDGGAGW
NT seq 582 nt   +upstreamnt  +downstreamnt
atgcctgaggaagcttgggcaatccttaagaaggcgagcgatgaaagagacttggaagat
ttccgtgaagcccttaagatctattccaaggctgttccgttggcaacatttgatgaaatt
gagaaaaagtttcgcgcagacaacttcaagatctaccttattgggctgtcggccacttcg
ccaaagattgccctgagaaaggtgtcaacagcagagcttgtcgcaattgcgggcaaagaa
gagggtcatatgtccaaggaatgtgacaagcctcgaaacatggataacgttacttgtcgt
aactgcgagaagactggccacatgagtcgcgactgccccgaggagaaggactggtcaaag
gtccagtgtaccaattgcaaggagatgggccacacgttcagacgctgtaacaaaccagct
gaaggtgctgacagtgacaatgcagatagctatggtggattctatggagcaggcattggc
agcaagaatcaccacgatcaaacacgtggccggaaggaaaccacagctcaatccgcagga
aactggtatgaagaaccaaccgacggcggcgctggttggtaa

DBGET integrated database retrieval system