KEGG   Coccidioides posadasii: CPC735_062240
Entry
CPC735_062240     CDS       T01332                                 

Definition
(RefSeq) polyketide synthase, putative
  KO
K15316  noranthrone synthase [EC:2.3.1.221]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00254  Aflatoxin biosynthesis
cpw01100  Metabolic pathways
cpw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    CPC735_062240
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:cpw01008]
    CPC735_062240
Enzymes [BR:cpw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.221  noranthrone synthase
     CPC735_062240
Polyketide biosynthesis proteins [BR:cpw01008]
 Polyketide synthase (PKS)
  Iterative type I PKS
   Fungal nonreducing PKS (NR-PKS)
    CPC735_062240
SSDB
Motif
Pfam: ketoacyl-synt SAT Acyl_transf_1 Ketoacyl-synt_C Thioesterase PP-binding PS-DH KAsynt_C_assoc Thiolase_N Abhydrolase_1
Other DBs
NCBI-GeneID: 9695991
NCBI-ProteinID: XP_003070496
UniProt: C5P3T3
Position
Unknown
AA seq 2242 aa
MAQDMQVFLFGDQTYDLVPDLRQLLRCNTKPILSAFLEQSHYVIRAQSATWLSPEEQQRS
RSSNLAHLLQKYSDGDLNPAFQVALHSLTQLACFINHYEEPGRPYPSPGRKYVVGLCTGA
LAAAAISSSSSLSELLPAAVHTVQVALRLGLLANDMKDRIETPTQESPREWSAAFFDMTE
AAAVSALVEFDSVTAITISGPPSVLRRLIKGRALGQYKSRTLPIFLPSHTPQLFSIQDVE
KVLEATNPVTWSRYNAKLPVLSGATGKSDWGGSFVSLLHRAVRECLMEPVRWDGVSDSVT
KIARSLEVKCVAVTPVGTNLEHSMSSSLKDITKVQIEPLKSSDSPLFDTVPVGKAKLAIV
GMSGRFPEAPTPEAFWDLLYEGLDVCKEVPAKRWDWRTHVTPDGKGHNLGGSKWGCWLDY
ADQFDPRFFSISPKEAPQMDPAQRMALMTTWEALEQSGFVSNTTPSTQNDRVGVFHGVTS
NDYLECNSGQYIDTYFITGGNRGFIPGRINFCFEFCGPSYTNDTACSSSLAAIHLACNSL
WRGDCDTAVAGGTNMCINPDGHTGLDKGFFLSRTGNCKPFDDQADGYCRGEGVATVIIKR
LDDAIAENDPILAVILDAKTNHSALSESMTRPHVGAQVENMRAVLNTSGLDPRELSYVEM
HGTGTQVGDAVEMQSVLNVFAPDNEFRGRDKPLYVGSAKANVGHGEGVSGITSLAKVLLM
MKHDTIPPHCGIKPGSRINRNYPDLKARNVHIASEPVPWTRGSEPRRVLINNFSAAGGNT
ALLLEDAPLKPVLADKDPRSSHIVTVSGHVVASLKENAQRLIDFIGKSGSNEYSLSQLSW
TTTARRAHHLFKIAVAGSTPMEVRQRLQEALASGDGTTRPKNKPKILFAFTGQGSQYIGM
AKSLFHAFPSFRSDICNFDRLAHHTMGFPSFLHIITSNTGDMNDQSPVVVQLAIVSLEIA
LARLLQSLGVVPSAVVGHSLGEYAALHIAGVMTLFDTLYLVGRRAEFIQELCDRGTQAML
AIKASHSTIRKLLNGKAYEVACVNGPEDTVISAANDVIDGAKAVLNHNGIKSTVLQTPFA
FHSAQVAPIMDLYTKTAEGVTFHKPSVPVLCPLTGKVVQEEGVFSAHYLVRHLREPVNMA
AALGTAYESRVLDDRTFTIEIGPHPVVCGMVKATLGSQMPTLAILSRGKDVWPLMTEALA
ALYRQGYNIIWGVYHAPFKSSHRVVELPAYGWDLKEYWIPYENDWCIYKPYGRPGYAGHK
AQSGNPIVLVDEPQSKTLPAPSVSIRKPQTTTIQTMISEDIHNTGATLVYEMDLNRPDAS
NVAGGHIVSNIPFTTPSVFADMAFVLGKYVVERFFKRPTVIDVANIVADKVLIPRGNGPQ
PIRVSMTMTWEPGQPQTLQAAQCEFYSVDAKGKTTARHSWCTVYFHDGTQRKKLASEVPR
ILSRIQRLRDGVDNGQFVRYNRASGYRLMSSVAHFHPDYKVLDDMVMDDETLEATCTLNF
GLLSSGGCFAAHPAFVDCMTQLGGFTVNAQESLDLSAEVYISHGWDSLQIYDSFKAERKY
QLYAQMKRDGSEFYHGDTCLLDGSTIIAYFKNVTVRRVSRKTHRAVMQTLVQRNTNAAAS
KGSADHKAAVHSPPVPKKPIAVSASKALPAVPSPTPKKAAELSAPKAMPAAAPLPVPLVA
KTRNKKPAPQDTISEPQKKARNVPTEQRTISAGGARAKQKIAECLQVIAEESGIAVDDLT
DDSNFADIGVDSLLSMVIASRFRENLGLDLDANFALFAECPTVKKLKEFIANFLGEPLET
QASQLRDDNDERLQEIPPPDTKPMLDTSYSTPLEPIPAESSSSAPSTGHTSETLVEMPSF
IKEDDSFLGVRAGGICSAGLAIVSEESGIAISDLTDETNFADIGVDSLLSMVIGSRFREE
LGLDLGADFSIFVNCPTVKKLKVFLNSHDASSEDDGSSDDAFGSSTSVSSMEEYADTKKA
EFTQLLDDDCRPATSVILQGIPKLARKTLFLLPDGSGSASSYVPIPKLNRDVAIVGLNCP
YVRDPENMNCTHTALLSSYYNEIRRRQPKGPYHLGGWSAGGGFAFACAELLIRDGEEVQS
LIIIDSPLPQQMETLPVEFYEHCATLGLYGNEKPPSYLIPHFLRTLETMLPYQATPLKTR
RLPKVGILWACETVMDAAGAPDIGERNHFMLRRRQDFGPDGWDTVLPGAEFVLGKAVGAN
HFTMMQKDHNQHIARLIEKVVG
NT seq 6729 nt   +upstreamnt  +downstreamnt
atggctcaggacatgcaggtcttcctctttggagaccaaacatatgatctcgtacctgat
cttcgacagctactacgctgcaatacaaagccaattcttagtgcctttttggaacaatct
cactatgtgatccgagcccaatctgctacttggctgtctccggaggagcaacagaggtcg
agaagttcgaacctcgcccatcttttgcagaagtattccgacggtgatttaaaccctgca
ttccaggtggctctgcattcattgacgcagctggcctgctttattaatcattatgaggag
cccggacgtccgtatccaagccctggccgaaaatatgttgtcggcctctgcactggtgct
ttggcggcagccgctatcagttcctccagctctctttccgaactactacccgcagcagtc
cacacagtccaagttgccctgcgcctcggcttgctcgctaatgacatgaaagaccgtatc
gaaacacccacgcaagagtctcctcgagagtggtccgccgcgttctttgacatgactgaa
gccgcagctgtgtccgctcttgtagagtttgatagcgtaacggcgattacaattagtggt
ccgccgtctgttctgcgacgtctcattaaaggtcgggctcttggacaatataaatccaga
actctccccatcttccttccctcccatactcctcaactattttccatccaggatgtggaa
aaagttcttgaagccacaaatcccgtaacatggtctagatataacgctaaattgcctgtg
ctatcgggcgccacggggaagtccgactggggaggcagctttgtgtcccttctccaccga
gcagtgcgtgaatgcctcatggagcctgttcgatgggacggggtgtccgacagcgtgacc
aagatcgctcgatcgctagaagtaaagtgcgtggctgtcactccggttggaacgaatctc
gaacacagcatgtcatcttctctgaaagatattacaaaggtacagatcgagccgctcaaa
agctcagactcacccttattcgacaccgtacccgtgggaaaggcaaagctggccattgtc
gggatgtctggtcgcttcccggaagccccaactccggaagcattttgggatcttctgtat
gagggcttggatgtctgtaaagaagtcccggccaagcgatgggattggcgcactcacgtt
actccagacggcaaaggccataatctagggggttcaaagtggggatgttggctcgattac
gcggaccagtttgatccccgttttttcagcatttccccgaaggaagcgccccagatggac
cctgcgcaacgtatggcactaatgactacatgggaggctctcgaacagtctggattcgta
tccaatactaccccttcgacccagaatgatcgagtcggagtattccatggcgttaccagt
aatgattacttggaatgcaatagcggccagtacattgacacgtatttcatcactggcggc
aatcgtggatttatccctggcagaatcaacttttgctttgaattctgtggacccagttac
acgaacgacacggcatgttcttcgagcttggctgctattcatctagcctgtaactccctt
tggcgaggagactgcgatacagccgttgcgggagggactaacatgtgcatcaatccagac
gggcacacaggtttagataaaggatttttcctgtcccgaacaggcaactgcaaaccgttt
gatgaccaggcagatggatactgccgcggtgaaggggtagcgactgtgattatcaagcgg
ttggatgacgcgattgccgagaacgacccaatcttagccgtcattcttgatgccaaaacg
aaccactcagcgctgtcggagtcaatgacgcgaccccatgtgggagcacaggttgagaac
atgcgtgcggtgctcaacacttcagggctagatccaagggagctgagctacgttgaaatg
catgggacagggacccaagtcggcgatgcggttgaaatgcaatctgttctgaatgtcttc
gctcctgacaacgagttccgagggcgcgacaagcctttgtatgtgggatctgcaaaagca
aacgttgggcacggggagggagtgtctgggattacgagtctggctaaagtgcttttgatg
atgaagcatgacaccatcccaccccattgtggaatcaagcctggtagcaggatcaatcgc
aactacccagacctgaaagcccgaaatgtgcatattgcttccgaacctgtgccttggact
cggggttctgagccacgccgagtcttgatcaataacttcagtgcggcgggaggcaacact
gctcttctccttgaagatgcgcccctaaaacctgtgctagctgacaaagaccctcgcagc
agccacattgtgacggtctccggacatgttgttgcttccctaaaggagaatgcccaacgg
ttaatcgactttattgggaagagcgggtcaaatgagtactcactctcccagctttcctgg
accacaaccgcaagacgcgctcatcacctgttcaaaattgcagtggctggttccacccca
atggaggtcaggcaacgtctgcaggaagccctcgctagcggggacggaactacaaggcct
aagaataaacccaaaatactatttgcgttcactgggcagggctctcaatacatcggcatg
gcaaaaagtctattccatgccttcccgagtttccgatcagatatctgcaattttgaccga
ctagctcaccataccatgggctttccttcgtttctccatattatcacatcgaacactgga
gacatgaatgaccagtcaccggtagtggttcagcttgcaattgtatcattggaaattgct
cttgcacggcttttgcagtctcttggggtggttcccagtgccgttgttggccatagcttg
ggagagtatgccgcactccacatcgcaggtgtcatgactctgtttgatactctgtatttg
gttggccgccgagccgagttcattcaggagctatgcgatcgtggaactcaggcgatgctt
gcaattaaagcctcacattcaactatcagaaaactcctcaacggcaaagcgtacgaggtt
gcatgcgttaatgggcccgaggataccgtcattagcgcagccaatgatgtaattgatggt
gccaaagcggtgctcaatcacaatggtattaagagcacggttctgcagacgccttttgca
ttccattccgcccaggttgcacctattatggacctctacaccaaaacagcggaaggtgtt
acctttcacaagccatctgtaccggtactatgtccgctcaccggcaaggtggtccaagaa
gaaggggtgttcagtgcccattatctggttcgccatctccgtgaaccggtgaatatggca
gctgctcttgggactgcctatgaatctcgggtattagatgacaggactttcactatcgag
ataggccctcatcctgttgtgtgtggtatggttaaagcgaccctcgggtctcagatgcca
acattagccatactctcacgtggaaaggatgtatggccattgatgactgaagctctggca
gcactttacaggcaagggtataacatcatatggggggtctatcatgctcctttcaagtcc
tcccatcgggttgtcgaacttccagcctatggatgggatttgaaggaatattggattcca
tacgagaacgactggtgcatatataagccgtacggccgacccggttatgctggccataaa
gctcagtccggcaatccaatcgtacttgtggatgagccgcagtcaaagactctccccgct
ccgtctgtgtccatacggaaacctcagacaacaacaatacagacaatgatttccgaagat
attcataatacaggggctactctagtgtatgagatggacttgaaccgacctgatgcaagc
aatgttgctggtggtcacattgttagcaacattccattcaccacgccatccgtctttgca
gatatggcatttgtgcttgggaaatatgttgtggaacgcttcttcaagcgtcccaccgtc
attgatgtggccaatattgtggcagacaaggtcttgatcccgcgcgggaatggaccccaa
cctatccgggtgtcaatgacaatgacatgggaaccgggtcaaccgcagactttgcaagca
gcgcaatgcgaattttacagtgtagatgccaagggaaaaacgacagctcgacactcgtgg
tgcactgtctacttccatgatggtacccaaagaaagaagcttgccagtgaagttccacgt
atcctatccagaatccaacgcctccgcgatggcgtagacaatggacagtttgtgagatac
aatcgagcaagcgggtacagactgatgagttctgttgcacacttccacccagactacaaa
gttttagatgatatggttatggatgatgagacgctcgaggcgacctgcacgctcaatttc
ggattgctttcatccggagggtgcttcgcagcacatcctgcattcgttgattgcatgaca
cagttgggtggatttactgtcaatgcacaagagagcctagacttatctgccgaggtctac
attagccatggatgggactcactccaaatctacgacagctttaaggctgaaagaaagtat
caactttacgcccagatgaagcgggacggaagcgagttctaccacggcgatacctgcctt
ctagatggaagcaccattatagcgtacttcaagaatgtcacagtccgacgagtctcgagg
aaaacccaccgcgccgttatgcagactctcgtgcagcgtaataccaatgcagcagcatca
aagggttcggctgaccacaaggctgctgttcatagcccccctgtgccgaaaaagcccatt
gcggtttctgcatcgaaggccctgccagcggtgccatcacctacgcccaaaaaggctgct
gagttgtccgcgccaaaggccatgccagcagctgctccattgcctgtaccattagtggcc
aagacaagaaataaaaaacctgcgccacaagataccatttcagaaccccagaagaaggca
agaaatgttccaacagagcagagaaccatttcagcgggtggcgcccgtgcgaagcagaag
atcgcggagtgtctgcaggtaattgcagaagaaagtggcatcgctgtggacgatcttacc
gacgatagcaactttgccgatatcggtgtcgactcactgttgtcaatggtcattgccagc
cgcttccgtgaaaacctcggtctagacctcgatgccaactttgcattattcgctgaatgc
cccacggtcaagaaactcaaggaattcattgcaaatttccttggtgagcccttggaaaca
caagcgtcacagctgcgggacgataatgatgagcggctgcaggagattccaccaccggat
acgaagccaatgctagatactagctatagtacgccgctggaaccgattcccgcagagtcc
tcatccagcgctccatccacgggccatacatctgaaacattggttgaaatgccctcgttc
atcaaggaggacgattcttttttaggagttcgagccggcggaatatgctccgctggttta
gcgatcgtgtccgaagaaagcggcatcgcaatttccgaccttactgacgaaacaaacttt
gcggacattggagtagactcccttttatccatggtcattggcagtcggttccgtgaggag
ctcggtttggacttgggtgctgacttctccatttttgtgaattgccctacagtgaagaag
ctcaaggtatttttaaatagccacgatgcatccagcgaagatgatggatcgtcagatgat
gcgtttggctcgtctacttctgtatcaagcatggaggaatatgccgataccaagaaagcg
gagttcactcagttgctcgacgacgactgccgaccagcaacatccgttatccttcagggt
attccgaaattggcccgcaagactcttttcttactcccagacggaagtggctcagcatcg
tcatacgtgccaattccaaagcttaatagggatgttgctattgtcggtctcaactgccct
tatgtccgcgaccccgagaacatgaactgcactcacaccgcccttctatcaagctactac
aacgaaatccgacgacggcaacccaagggcccctaccacctaggcggctggtccgctggt
ggaggttttgccttcgcatgcgccgagctccttatccgcgacggtgaggaggtgcagagc
ttgatcattatcgactctcctctcccccaacagatggagacccttcctgtcgaattttat
gagcactgtgctactcttggattgtacggtaatgagaaaccccccagctatctcattcct
catttccttcgcaccctggagaccatgcttccgtaccaggcaacacctttgaaaaccaga
aggttgcctaaggttggaatcctgtgggcctgcgagacggttatggatgctgccggcgcg
cctgatattggcgagagaaaccatttcatgctgcgacggaggcaggattttgggcccgat
ggatgggacacagtcctcccaggggcggaatttgtgctaggcaaagctgtcggcgcgaat
cactttacaatgatgcaaaaggatcataaccaacatattgcacgattgattgagaaagtc
gtaggttag

DBGET integrated database retrieval system