KEGG   Coccidioides posadasii: CPC735_064980Help
Entry
CPC735_064980     CDS       T01332                                 

Definition
(RefSeq) septin 2
  KO
K16944  septin 7
Organism
cpw  Coccidioides posadasii
Brite
KEGG Orthology (KO) [BR:cpw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cpw04131]
    CPC735_064980
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cpw04812]
    CPC735_064980
   04147 Exosome [BR:cpw04147]
    CPC735_064980
Membrane trafficking [BR:cpw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    CPC735_064980
Cytoskeleton proteins [BR:cpw04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     CPC735_064980
Exosome [BR:cpw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CPC735_064980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 GTP_EFTU ABC_tran Roc AAA_16 AIG1 RsgA_GTPase AAA_22 Ras AAA_29 AAA_24 FtsK_SpoIIIE Sigma54_activat AAA_7 RNA_helicase Exonuc_VII_L Dynamin_N
Motif
Other DBs
NCBI-GeneID: 9693026
NCBI-ProteinID: XP_003067543
UniProt: C5PBS1
Position
Unknown
AA seq 405 aa AA seqDB search
MRNVVRRKLTGYVGFANLPNQWHRKSVRKGFNFNVMVVGESGLGKSTLVNTLFNTSLYPP
KERKGPSLDIIPKTVSIQSISADIEENGVRLRLTVVDTPGFGDFVNNDDSWRPIVENIEQ
RFDAYLDAENKVNRMNIVDNRVHACVYFIQPTGHSLKPLDIEVMRRLHTKVNLIPVIAKA
DTLTDEEVALFKQRILADIHHHSIQIFEGPRYELDDEETLAENQEIMSKVPFAVVGANTE
VTTASGHKVRGRRYPWGIIEVDNEEHCDFVKLRQMLIRTHMEELKEHTNNVLYENYRSDK
LTAMGVTQDPSVFKEVNPAVKQEEERALHEQKLAKMEAEMKMVFQQKVQEKESKLKQSED
ELYARHREMKEQLERQRLELEDKKARLESGRPLEDKIKRKGFSLR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatgtcgttcgccggaaattgactggctatgtcggctttgccaacctgccgaac
cagtggcaccgcaagagtgtgcgaaagggtttcaatttcaatgtcatggtcgtcggtgag
tctggtttgggaaagtctactctagtgaacactctcttcaacacctccctatacccaccc
aaggagcgcaagggccccagccttgatatcatccctaaaactgtttcgattcaatctatc
agcgctgatatcgaggagaacggcgttcgtctacgattgaccgttgtcgatacccctggg
ttcggtgattttgttaacaacgacgactcttggcgtcctattgtcgagaacatcgagcag
cgatttgacgcctaccttgatgcggagaacaaggtcaaccgtatgaacatcgtcgataac
cgtgtgcacgcatgtgtctacttcattcagcccactggccactcactgaagccccttgac
atcgaggttatgcgtcgcctgcacaccaaggtcaacttgatccccgtcatcgccaaggct
gataccttgaccgacgaggaagtcgctctcttcaagcagagaattcttgccgatatccac
catcactccatccagatcttcgaaggtccccgttatgaactcgacgacgaagaaaccctt
gctgagaaccaggagatcatgtccaaggtcccttttgccgttgtcggtgcaaacactgag
gttaccaccgccagcggtcacaaagtaagaggtcgccgttatccatggggtatcatcgaa
gtagacaacgaggagcactgcgactttgtcaaactgcgccagatgcttatccgtacccac
atggaagagctcaaggaacacaccaataacgtcttgtatgagaactaccggtccgacaaa
ctgacagcaatgggtgtgacgcaagacccaagcgtcttcaaggaggtcaaccctgctgtg
aaacaggaagaagagcgcgctctgcacgaacagaaacttgccaagatggaagcagaaatg
aagatggtgttccaacagaaggtgcaagagaaagagagcaagctgaaacagagtgaggac
gaactatatgctcgacatcgtgagatgaaagagcaactagaacggcagcggctcgagcta
gaggacaagaaggcccgcctcgaaagtggacgacctctcgaagacaagataaagcggaaa
gggttctcacttcgttag

DBGET integrated database retrieval system