KEGG   Corynebacterium pseudotuberculosis I19: CpI19_1210Help
Entry
CpI19_1210        CDS       T01878                                 

Gene name
ppgk
Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cpx  Corynebacterium pseudotuberculosis I19
Pathway
cpx00010  Glycolysis / Gluconeogenesis
cpx00520  Amino sugar and nucleotide sugar metabolism
cpx01100  Metabolic pathways
cpx01110  Biosynthesis of secondary metabolites
cpx01120  Microbial metabolism in diverse environments
cpx01130  Biosynthesis of antibiotics
cpx01200  Carbon metabolism
Module
cpx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpI19_1210 (ppgk)
   00520 Amino sugar and nucleotide sugar metabolism
    CpI19_1210 (ppgk)
Enzymes [BR:cpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CpI19_1210 (ppgk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADO26477
Position
complement(1158612..1159388)
Genome map
AA seq 258 aa AA seqDB search
MPFSKLKFMTRIGFGIDVGGSGIKGARVDLDTGDFVGDRIKILTPKPATPEAVAQTISRI
VAEAEWEGPVGITLPSVIRNQVALSAANIDQSWINVDVQKLFTKTLGGRNIAVLNDADAA
GIAEVAFGEDQARRGSAILLTLGTGIGSAFFINGVLFPNTELGHMIVEGKEAEHLASSAA
KDRDELSYSKWAKRVSKVLSEYERLFWPDVFIVGGGISRKADKWVPKLTIDTPVIPAKLR
NTAGIVGAAMAADQNIRP
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgccattcagtaagctcaagttcatgacacgaattggctttggcattgatgttggcgga
tctgggattaaaggtgcccgcgttgatctggataccggtgattttgtcggagatcggatc
aaaattttaacccccaagcctgccacccccgaagcggtcgcccaaacgatttctcgcatt
gttgcagaggccgaatgggaaggacccgtcggaataacgctgccttccgtaatccggaat
caagtagcactttctgccgccaacattgaccaatcatggatcaatgttgatgttcaaaaa
ttatttaccaagaccctgggcgggcgtaacatcgcagtgcttaacgacgccgatgcggcg
ggcatcgccgaggtagccttcggagaagatcaagctcgacgtggttccgccattttgctc
actctaggcactgggatcggttccgctttctttatcaacggggtcttattccccaacacc
gagttagggcacatgatcgtagagggaaaggaagccgagcatctagcttcatctgcagca
aaagatcgcgatgagttgagctattccaaatgggccaagcgcgtttctaaagtcctcagc
gaatacgaacgacttttttggccagacgtttttatcgtaggcggtggtatctcacgcaaa
gctgataaatgggtacccaaactcactatcgatacgcccgtcatacctgcaaaactacgt
aataccgcaggtatcgtaggagcagcaatggcggcagaccaaaatatcaggccttag

DBGET integrated database retrieval system