KEGG   Corynebacterium pseudotuberculosis I19: CpI19_1364Help
Entry
CpI19_1364        CDS       T01878                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
cpx  Corynebacterium pseudotuberculosis I19
Pathway
cpx00340  Histidine metabolism
cpx01100  Metabolic pathways
cpx01110  Biosynthesis of secondary metabolites
cpx01230  Biosynthesis of amino acids
Module
cpx_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cpx00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    CpI19_1364 (hisD)
Enzymes [BR:cpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CpI19_1364 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADO26628
Position
983878..985203
Genome map
AA seq 441 aa AA seqDB search
MLSLIDLRGHAPTTSELRRALPRGGTDVNSVTHIVEPVLHKIQEHGAQAALDFGEKFDRV
RPASVRVPQDVIDAALESLSPEVKQALEEAIARVRKVHADQKPQEHATKLDTGAIVTEVF
LPVERVGLYVPGGNAVYPSSVVMNVVPAQEAGVTSLVVASPPQADFGGWPHPTILAAAKL
LGVAEVWAVGGAQAVGLLAYGDDSEGLEPVDMITGPGNIFVTAAKRLVNGVVGIDSEAGP
TEIAIVADESANPVWIAYDLISQAEHDVLAASVLITDSEILAERVNAEVKSRFEITRNSD
RVVQALQGKQSGIVLVDDMATALTVADAYAAEHLEIHTANAQEDARKIRNAGAIFVGGFS
PVPLGDYAAGSNHVLPTSGSARYSSGLSTHTFLRAVNLIEYDETALKGISDTIVALANAE
ALPAHGEAIRSRFENLIAEQI
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcctgatcgatctacgcggacatgcccctactactagtgaactccgtcgtgcc
ctcccacgcggaggcactgacgttaactccgtaacacatattgttgagccagttctgcat
aagatccaagaacacggagcccaggcagcccttgattttggtgaaaaatttgatcgcgtt
aggccagcaagcgtgagggttcctcaagacgtgattgatgctgctctggagtctttgtct
cctgaggtaaagcaggcgctcgaagaagcgattgctcgagtgcgcaaagtgcacgctgat
caaaagccgcaggaacatgcgacaaagcttgatacgggggccattgttacagaagtattt
cttcctgttgaacgcgtagggctatacgtcccgggtggtaatgcggtgtatccctcaagc
gttgttatgaacgtagttcccgcgcaggaggctggcgttacgtctttagttgtggcctcg
ccacctcaagctgactttggtggttggcctcatccgacgattctcgccgctgcgaaattg
ctgggggttgctgaagtatgggcggttgggggcgcacaggcggtaggactgctagcctat
ggcgatgattccgaggggttggagcctgtggatatgattactggccccggtaacattttt
gttactgcggccaaacgcctggtcaatggtgtagttggtattgattcagaagctgggcca
actgaaattgccatcgtagctgatgagagcgctaacccagtatggatagcatacgatctt
attagccaggcggagcatgatgttttagccgcctcggtgttgatcacggattctgagatc
ctcgcagaacgcgtgaatgctgaagtgaagtctcgatttgaaattacgcgtaattcagac
cgggttgtacaggccctccaaggaaaacaatcgggcattgtgcttgtcgacgatatggcg
accgcacttactgtcgccgatgcctatgcggcagagcacttggagattcatacagcgaat
gcccaagaggacgctcgtaagatacgcaacgcaggcgctatctttgtcggaggcttttca
ccggttccgcttggagattatgcggcaggttctaatcacgttcttccgacgtcggggagc
gcacgttacagctcagggctttccacacatacgttccttcgcgcggtgaatctcattgaa
tatgatgagaccgccttaaagggtatttcggatactatcgttgcgcttgccaacgcagag
gcgcttcctgcacatggagaagctattcgttccagatttgaaaacctcattgcagagcaa
atttga

DBGET integrated database retrieval system