KEGG   Corynebacterium pseudotuberculosis I19: CpI19_1421Help
Entry
CpI19_1421        CDS       T01878                                 

Gene name
glk
Definition
(GenBank) Glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cpx  Corynebacterium pseudotuberculosis I19
Pathway
cpx00010  Glycolysis / Gluconeogenesis
cpx00052  Galactose metabolism
cpx00500  Starch and sucrose metabolism
cpx00520  Amino sugar and nucleotide sugar metabolism
cpx00521  Streptomycin biosynthesis
cpx01100  Metabolic pathways
cpx01110  Biosynthesis of secondary metabolites
cpx01120  Microbial metabolism in diverse environments
cpx01130  Biosynthesis of antibiotics
cpx01200  Carbon metabolism
Module
cpx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpI19_1421 (glk)
   00052 Galactose metabolism
    CpI19_1421 (glk)
   00500 Starch and sucrose metabolism
    CpI19_1421 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CpI19_1421 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CpI19_1421 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CpI19_1421 (glk)
Enzymes [BR:cpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CpI19_1421 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase TCR FGGY_N DEDD_Tnp_IS110 Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ADO26684
Position
921668..922621
Genome map
AA seq 317 aa AA seqDB search
MSERSDAVTVGFDIGGTNMRAAAVTSDGQIIDSMSVPTPSTPELLESGIIGLVDNLKQKH
EVSAVGLAVAGFLDPDCEVVRFAPHLPWRDRHVRAELSDALGLPVRLEHDANSAAWGEYR
FGAAQGADNWVLFAVGTGIGATLMHQGEIYRGAFGTAPEFGHLTVVPGGRTCSCGKRGCL
ERYCSGTALETTAREMIAAGKATESVLIDYLADGSLSGKRIMAAASDGDQLACAVVEDFA
QWMGRALSVVADVLDPGLIVIGGGVSTASALYIDTAVETMAASMVGAGYRPLPTVSCAKL
GGDAGMIGVSDLARQLV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaagatccgacgcagtcaccgtgggctttgatattggtggcactaacatgcgg
gcggcggcggtgacttcggatggtcagattattgactctatgtcggttcctacgccatca
actcctgaattacttgaatcgggcatcatcgggttggtggataacctgaagcaaaaacac
gaggtttccgcagtaggcctcgccgtagctggcttcttggatcctgattgtgaggtcgtt
cgttttgctccacaccttccgtggagagaccggcatgtccgtgcagaactttcagatgct
ttagggctacctgtccggcttgagcacgatgcaaattctgctgcatggggagaatatcgg
tttggtgccgctcagggggcagataactgggttctttttgccgtgggaacgggaattggt
gcaacccttatgcatcaaggagaaatttaccgtggggcttttggcacagcgccggaattc
gggcacctcactgtggtaccagggggacgaacatgttcctgcggtaaacgagggtgcctt
gaacgctactgttcgggaactgccctggaaactactgcccgcgagatgatcgcggcgggc
aaagcaacagagtccgtgcttatcgactatctagctgatggttccctgagcggtaagcgc
attatggccgcagctagcgacggtgatcagctggcttgcgctgtagttgaagattttgcg
caatggatggggcgagccctatccgtggttgccgatgtccttgatcccggtcttattgtg
attggtgggggcgtatccactgcaagcgcgctttatattgatactgctgtggagacaatg
gctgcatcgatggtgggggcaggataccgcccccttcccacagtttcgtgtgcgaagcta
ggcggagatgcgggtatgatcggggtatctgatttggctcgccaattggtttga

DBGET integrated database retrieval system