KEGG   Corynebacterium pseudotuberculosis I19: CpI19_1715Help
Entry
CpI19_1715        CDS       T01878                                 

Gene name
cat1
Definition
(GenBank) Succinyl-CoA Coenzyme A transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
cpx  Corynebacterium pseudotuberculosis I19
Pathway
cpx00020  Citrate cycle (TCA cycle)
cpx00620  Pyruvate metabolism
cpx00650  Butanoate metabolism
cpx01100  Metabolic pathways
cpx01110  Biosynthesis of secondary metabolites
cpx01120  Microbial metabolism in diverse environments
cpx01130  Biosynthesis of antibiotics
cpx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CpI19_1715 (cat1)
   00620 Pyruvate metabolism
    CpI19_1715 (cat1)
   00650 Butanoate metabolism
    CpI19_1715 (cat1)
Enzymes [BR:cpx01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     CpI19_1715 (cat1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: ADO26969
Position
complement(1874428..1875933)
Genome map
AA seq 501 aa AA seqDB search
MSDRIANAQLRGKIMSAQEAAQLVDNGDKVGVSGFTGAGYPKVMPAAIAERAKEAQAKGE
SYTIDLFTGASTAPDCDGVLAEAGALRFRMPYQSDPSMRKAINSGNMLYSDIHLSHSGAM
VAEGFFGQLNVAIVEAVRIKEDGSIVPSSSVGNSVEYLDAAEKIIIEVNSWQSEELEGMH
DIWRMPRTPNRIAIPIKNTGDRIGDTSISIDINKVVAVVETDAPDRNAPFKPLDDVSREI
ASNFLGFLEGEVKAGRLDYDRYIMQSGVGNVPNAVMAGLLDSKFENIQAYTEVIQDGMVD
LIDAGKMTVASATSFSLSPEYADKMNEHAEFYRKHIVLRPQQISNHPEVIRRTGLIASNG
MIEADIYGNVNSTHVNGVRMMNGIGGSGDFTRNALISTFISPSVAKDGAISAIVPFASHI
DHTEHDVMVLITEYGVADLRGLAPRERVQKAISVAHPDYRPLLEEYFEAAKKATPFMQTP
HDLTQAFSFHHRMNETGTMAK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcgcattgctaacgcacagttgcggggcaaaattatgtcggcacaagaggcc
gctcagctcgtagataacggtgacaaagtcggtgtctcgggcttcacgggtgccggctac
ccaaaggttatgcctgctgcgatcgccgagcgagcaaaggaagcacaggctaaaggggaa
agctacaccattgacctctttaccggcgcttccaccgcaccggactgcgacggcgtgtta
gcagaagccggagctttgcgtttccgaatgccatatcagtcagaccccagcatgcgtaag
gccattaactcgggcaacatgctgtactccgatatccacctgtctcattcgggcgcgatg
gtagcggaaggcttctttggtcagctgaacgtggctattgttgaggccgttcgtattaaa
gaagacggatcgattgtgccgtcttcctccgtaggaaattccgtggaataccttgatgcg
gcagagaagatcatcatcgaggtcaactcgtggcagtccgaggaacttgagggaatgcac
gacatttggaggatgccgcgtacccccaaccggattgctatccctattaagaacaccggt
gatcgcatcggtgatacctcgatttctattgacatcaacaaggtagtagcagtcgttgag
actgatgctcctgaccgcaacgctccttttaagcctctcgacgacgtctcccgcgagata
gcctcgaacttcttgggcttcctcgaaggggaagttaaagctggtcgactcgactatgat
cgctacatcatgcagtccggcgtaggtaacgttcccaacgccgtgatggcaggcctattg
gactccaagtttgaaaatatccaggcctacaccgaggtcatccaagacggcatggtcgac
ctgatcgatgccggcaagatgaccgttgcttctgccacctcattttcgctgtccccggag
tatgcggacaagatgaatgagcacgcagagttctaccgcaagcacatcgttctgcgtcct
caacagatctccaaccatcctgaggtgatccgtcgcaccgggttgatcgcttccaacggc
atgatcgaggctgacatttacggcaacgtgaactccacacacgttaatggtgtgcgcatg
atgaacggcatcggaggatccggtgactttacccgtaacgctttgatctccaccttcata
tctccatcggtggctaaggatggcgctatctccgctatcgttccattcgcatctcatatc
gaccacacggagcacgacgtcatggtgctcattacggaatacggtgttgcagacttgcgc
gggcttgcaccacgagagcgtgtgcagaaggccatctccgttgcccatccggattaccgt
cctttgctggaggaatactttgaggcggcaaagaaggcaacgcctttcatgcagaccccg
catgacctcactcaggctttctcattccaccaccgcatgaatgagaccggaacaatggct
aagtaa

DBGET integrated database retrieval system