KEGG   Lachnoclostridium phytofermentans: Cphy_2823
Entry
Cphy_2823         CDS       T00619                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
cpy00620  Pyruvate metabolism
cpy00640  Propanoate metabolism
cpy00650  Butanoate metabolism
cpy01100  Metabolic pathways
cpy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cphy_2823
   00640 Propanoate metabolism
    Cphy_2823
   00650 Butanoate metabolism
    Cphy_2823
Enzymes [BR:cpy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Cphy_2823
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029 ATP-synt_D
Other DBs
NCBI-ProteinID: ABX43183
UniProt: A9KP13
Position
complement(3443643..3445703)
AA seq 686 aa
MMTSVMKQEWEGFKQGRWITSVNVRDFIQNNYTMYDGDESFLAGPTEATNKLWAQVMELS
KQESEKGGVLDMDTKIVSTIVSHGPGYLDKDIETIVGFQTDKPFKRSLQVFGGIRMAQSA
CHEYGYEVDEEVARIFTDYRKTHNQGVFDAYTDEMKLARKSAIITGLPDAYGRGRIIGDY
RRVALYGTDLLIEDKKEQLTTSLKRMTSDNIRLREELAEQIRALKELAKLGEIYGYDITK
PAINAKEAIQWLYFGYLAAVKEQNGAAMSLGRTSTFLDIYIQRDLDNGVITEKEAQEYID
HFIMKLRLVKFARTPEYNALFSGDPTWVTESIAGIGTDGRHMVTKTSFRYLHTLDNLGTA
PEPNMTVLWSTRLPRLFKEYCAKMSIKSSSIQYENDDIMRPTHGDDYAIACCVSSMKIGK
EMQFFGARANLAKCLLYAINGGVDEVLKIQVGPKYRPVEGEYLNYEDVMSKYKDMMEWLA
ELYVNTLNVIHYMHDKYSYERIQMALHDREVKRYFATGIAGLSVVADSLSAIKYAKVKVI
RDENGVVTDYEIEGDYPKYGNNDDRVDDIAVQLVHDFMNMIRKHHTYRDGYPTMSILTIT
SNVVYGKKTGNTPDGRKKGEPLAPGANPMHRRDTHGAAASLASVAKLPFRDAQDGISNTF
SIVPGALGKNDVLFAGDLDLDDMSEN
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgatgacttcagttatgaaacaggaatgggaaggttttaaacaaggtagatggatcact
tcagtaaatgttcgagacttcatacagaacaattacacaatgtatgatggtgatgaatcc
tttttagcaggtccaaccgaagccaccaataaactatgggcccaggttatggagctttca
aagcaggaaagtgagaaaggtggagtccttgatatggacaccaagatagtatctactatt
gtttctcacggtcctggttatttagataaagatattgaaacaattgttggttttcagacc
gataagccatttaagagatcactacaggtctttggtggtattcgtatggcacagagtgct
tgccatgaatatggatatgaggtagacgaagaggtagcacgtatttttacagactaccgc
aagacacataatcaaggtgtatttgatgcatacactgacgaaatgaagctcgctagaaaa
tcagcaatcattactggtttgcctgatgcttatggtagaggtagaattattggcgattac
cgtcgagtggcactttacggtactgatttacttattgaagacaagaaagaacaacttaca
acttccttaaagagaatgactagtgataatattcgcttaagagaagaattagcagaacaa
attcgtgcattaaaagaattagcgaagcttggtgaaatctatggttacgatattacgaag
ccagcaataaatgcaaaggaagcaattcagtggctttactttggatatcttgcagcggta
aaagagcaaaacggtgctgcaatgagcttaggccgtacttctacattccttgatatttat
atccagagagatttagataatggtgttatcacagaaaaagaagcacaagagtatatcgat
cattttattatgaaacttcgtctagtgaagtttgcaagaactccagaatacaatgcctta
ttctccggtgaccctacttgggtaacagaaagtatcgctgggattggtacagatggacgc
catatggtaacaaagacatccttccgttaccttcatacgttagacaaccttggaactgct
ccagaaccaaacatgacagttctatggtcaactagattaccaagattatttaaagagtac
tgtgctaagatgtcaattaagtcatcctctattcaatacgaaaatgatgatatcatgcgt
ccaactcatggtgatgattatgcaattgcttgttgtgtatcctctatgaaaattggtaaa
gagatgcagttctttggagcacgtgcaaatcttgctaagtgtcttctttacgcaatcaat
ggtggtgtagatgaagttcttaaaattcaggttggtccaaagtaccgtccagttgagggt
gaataccttaattatgaggacgtaatgtcgaaatacaaagatatgatggagtggctagca
gaactttatgtgaatactttaaatgtaatccactacatgcatgataaatatagctatgaa
agaattcaaatggcacttcatgatcgtgaagtaaaacgttactttgcaactggtattgcg
ggtctttctgttgtagcggactctttaagtgcaattaagtatgctaaggtaaaagtaatt
cgtgatgagaatggcgttgtaaccgattacgaaattgaaggtgattatccaaagtacggc
aacaatgatgatcgtgtagacgatatcgctgtacagttagtgcatgactttatgaacatg
attcgcaagcatcatacttatcgtgatggatacccaacgatgtcaatcttaacgataact
tctaatgtagtttatggaaagaagacaggtaatactccagacggacgtaagaagggtgaa
ccattagcaccaggtgctaacccaatgcatcgtcgtgatactcatggtgcagcagcgtcc
ctagcatcggtagcaaagcttccattccgtgatgcgcaggatggtatttctaatacgttc
tctattgtaccaggagcattaggtaagaatgatgtgttatttgctggagacttagattta
gacgatatgtctgagaactaa

DBGET integrated database retrieval system