KEGG   Lachnoclostridium phytofermentans: Cphy_2334Help
Entry
Cphy_2334         CDS       T00619                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
cpy00790  Folate biosynthesis
cpy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cphy_2334
Enzymes [BR:cpy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Cphy_2334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: ABX42695
UniProt: A9KKW3
Position
2876608..2877192
Genome map
AA seq 194 aa AA seqDB search
MSIDKNLIQESVSNILIALGEDPLREGLIDTPKRVANMYEEVFLGIQYTNDDIVTMFNKC
FEEDQNTFLANGIVWIKDIECFSFCEHHMTLIYDMHITIGYKPLHKVIGISKIARIADMV
CKRLQIQERIASDILEILTKITGSDDIFIKIEGKHGCMTSRGIQKPHATTCTILTSGIFQ
HNPMSFITKESGHV
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgagtattgacaaaaatttgattcaagagagcgtgtctaatattttaattgctcttgga
gaagaccccttaagagaaggtttaatcgatacgccgaaacgagtcgcaaatatgtatgag
gaagtttttttaggaattcaatatacaaacgatgatattgttaccatgtttaataaatgc
tttgaagaagatcaaaatacatttctcgcaaatggtattgtatggattaaggatatcgaa
tgctttagcttttgtgaacaccacatgactttaatatacgatatgcatatcaccattgga
tataaaccacttcataaagtaattgggataagtaaaatagcacgtattgcagatatggta
tgtaagaggctgcaaattcaagagaggatcgcctctgatatcttagaaattcttactaaa
attacgggaagtgatgatatctttattaagattgaggggaaacacggatgcatgacctct
cgtggaatccaaaagccacatgctacgacatgtacaatcttaacaagtggaatctttcaa
cataatcctatgtcgttcatcacaaaggagagtggtcatgtatga

DBGET integrated database retrieval system