KEGG   Lachnoclostridium phytofermentans: Cphy_2433Help
Entry
Cphy_2433         CDS       T00619                                 

Definition
(GenBank) Oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
cpy00620  Pyruvate metabolism
cpy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cphy_2433
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpy02000]
    Cphy_2433
Enzymes [BR:cpy01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Cphy_2433
Transporters [BR:cpy02000]
 Other transporters
  Primary active transporters [TC:3]
   Cphy_2433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-ProteinID: ABX42794
UniProt: A9KLQ0
Position
complement(2987162..2988574)
Genome map
AA seq 470 aa AA seqDB search
MTEQVKKPVKITETILRDAHQSLIATRMTTEQMLPILELMDKVGYHAVECWGGATFDASL
RFLKEDPWERLRKLRAGFKNTKLQMLFRGQNILGYRHYADDVVEYFVQKSVANGIDIIRI
FDALNDLRNLQCAVNAANKEKCHAQIAISYTLGDAYTTEYYVNMAKQIEEMGADSICIKD
MAGLLVPYEATNLVTAIKGEVKIPIDLHTHYTSGVAGMTYLKAVEAGCDIIDTAMSPFAM
GTSQPATEVMVETFKGTPYDTGFDQDLLAEIADYFRPMQEEALKSGLLNPKVMGVDIKTL
LYQVPGGMLSNLVSQLKEQNAEDKYYDVLQEIPRVRRDFGEPPLVTPSSQIVGTQAVLNV
LAGERYKMITKESKAILSGEYGQTVKPFDPEVQKKAIGDKKPITCRPADLLEPELDKIEQ
EMIEWKQQDEDVLSYALFPQVATEFFKYRQTQQTKVDVTVADTENKAYPV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcaagtaaaaaaaccggtaaagattaccgaaacgatattacgtgatgcacat
cagtcattaatcgcgaccagaatgacaaccgagcagatgctccctatattagaattgatg
gacaaagtagggtatcatgcagtggagtgctggggtggagctacatttgatgcatcttta
cgtttcttaaaagaagacccttgggaaagacttagaaagttaagagcgggttttaagaat
acaaagttacagatgctatttcgtggccagaacattcttggatatcgccattatgcggat
gatgttgtagagtattttgtacaaaagtccgttgcaaacggtattgatatcattcgtatt
tttgatgcgttaaatgaccttagaaatctacaatgtgctgtaaatgctgcaaataaagaa
aagtgtcatgctcaaattgcaatttcctatacccttggtgatgcctatactacagaatac
tatgtaaatatggcaaaacaaatagaggaaatgggtgcagattctatctgtattaaagat
atggcaggacttctagtaccatatgaagctaccaatcttgttactgcaattaagggagaa
gtcaagattccaatcgatttacatactcactatacttccggtgttgctggaatgacctat
ttaaaggcagtagaggcaggttgtgatattattgatactgcaatgtctccatttgctatg
ggtacgagtcagccagcaacggaggtaatggtagagacctttaagggaactccatatgat
acaggatttgatcaagatttattagctgaaattgcagattacttccgcccaatgcaggag
gaagcgttaaagagtggtttattaaatcctaaggttatgggtgttgatattaagacatta
ttatatcaggtaccaggtggtatgcttagtaatttagtatctcaattaaaagaacaaaat
gcagaggataagtattatgatgtgttacaagaaattccacgcgttcgtagagattttggt
gaaccacctctagtaactcctagttctcagattgttggtactcaggcagttcttaatgta
cttgccggtgagagatataagatgattacaaaagaaagtaaggccattttaagcggtgag
tatggccagacggtaaaaccatttgatcctgaggttcagaaaaaagcgattggggataag
aaaccaattacctgccgtcctgcagacctacttgagccggaattagataaaatcgagcag
gaaatgattgagtggaagcagcaggatgaggatgttttatcctatgcattgttcccacag
gtggctacggaattctttaagtatcgtcaaactcagcagacaaaggtagatgttactgta
gcagatacggagaataaggcttatccagtatag

DBGET integrated database retrieval system