KEGG   Lachnoclostridium phytofermentans: Cphy_2651Help
Entry
Cphy_2651         CDS       T00619                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
cpy00010  Glycolysis / Gluconeogenesis
cpy00260  Glycine, serine and threonine metabolism
cpy00680  Methane metabolism
cpy01100  Metabolic pathways
cpy01110  Biosynthesis of secondary metabolites
cpy01120  Microbial metabolism in diverse environments
cpy01130  Biosynthesis of antibiotics
cpy01200  Carbon metabolism
cpy01230  Biosynthesis of amino acids
Module
cpy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cpy_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cphy_2651
  Energy metabolism
   00680 Methane metabolism
    Cphy_2651
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cphy_2651
Enzymes [BR:cpy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cphy_2651
Membrane trafficking [BR:cpy04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Cphy_2651
Exosome [BR:cpy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cphy_2651
  Exosomal proteins of melanoma cells
   Cphy_2651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Sugar-bind
Motif
Other DBs
NCBI-ProteinID: ABX43012
UniProt: A9KN01
Position
complement(3237415..3238164)
Genome map
AA seq 249 aa AA seqDB search
MKLVLLRHGESEWNKENLFTGWMDVDLSETGKAEAASAGITLKQKGYDFDVCYTSYLKRA
IHTLNLALDEMDRVWLPVVKSWKLNERHYGTLQGLNKSETAERYGEEQVKIWRRSYDIAP
PLLKEEDERNPRFQEQYRQEKCEILPLGESLKDTIARVVPYYNEVILKDMMAGKRVLIAA
HGNSLRALMKYLEDMSPEDILNVNLPTGIPLVYELDEEGKFISKEYLGDAEYVKAKIEKV
SAQGKVTIE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagtattattaagacatggcgaaagtgaatggaataaggaaaatttatttact
ggttggatggatgtcgatttgtctgaaactgggaaagcagaagcggcctctgcaggcatc
acgctgaaacaaaagggatatgattttgatgtctgttatacttcttacttaaaacgtgcg
attcataccttaaacttagcgttggatgagatggacagagtatggctacctgtcgtgaaa
agctggaaactcaatgagagacattatggtacgttacaaggattaaataaatcagagaca
gcagagagatatggagaggaacaggttaaaatctggagacgtagttatgatatcgcacca
cctctacttaaagaagaagacgaacgaaatccaagatttcaagagcaatatagacaagaa
aaatgtgagatacttcctttaggagaaagcctaaaagatactattgcgagagtagttcct
tattataacgaagtcatattaaaagatatgatggcaggaaagagagtgttaatagcagca
catggtaattcactacgtgcactgatgaaatatttggaagatatgtctccagaagatata
ttaaatgttaatcttcctactgggatacctttggtttatgaacttgatgaagaaggaaaa
tttattagtaaagagtatcttggagatgcagagtatgtaaaagctaagatagaaaaagta
tctgctcaaggaaaggttacaattgaataa

DBGET integrated database retrieval system