KEGG   Lachnoclostridium phytofermentans: Cphy_3477Help
Entry
Cphy_3477         CDS       T00619                                 

Definition
(GenBank) phenylalanyl-tRNA synthetase, alpha subunit
  KO
K01889  phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
cpy00970  Aminoacyl-tRNA biosynthesis
Module
cpy_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:cpy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cphy_3477
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpy01007]
    Cphy_3477
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cpy03016]
    Cphy_3477
Enzymes [BR:cpy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     Cphy_3477
Amino acid related enzymes [BR:cpy01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   Cphy_3477
Transfer RNA biogenesis [BR:cpy03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Cphy_3477
 Prokaryotic Type
    Cphy_3477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2d Phe_tRNA-synt_N tRNA_synthFbeta
Motif
Other DBs
NCBI-ProteinID: ABX43828
UniProt: A9KHY1
Position
complement(4285529..4286548)
Genome map
AA seq 339 aa AA seqDB search
MNQTLMEIKERALSQINASDTLDALNEIRVNFLGKKGELTSVLKSMKDVAPEDRPKVGQL
VNEARESLEEALESKKEAFGKVLREAKMKAETIDVTLPAKKPMLGHRHPNTIALEEAERI
FVGMGYEVVEGPEIEYDYYNFEALNIPANHPAKDEQDTFYVTSNILLRTQTSPVQVHVME
QGKLPIRMIAPGRVFRSDEVDATHSPSFHQIEGLVIDKNITFADLKGTLAEFAKQLFGEE
TKVKFRPHHFPFTEPSAEVDVSCFKCGGKGCRFCKGSGWIEILGCGMVHPRVLEMSGIDP
EEYTGFAFGVGLERIALLKYEIDDMRLLYENDMRFLKQF
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaacattgatggaaatcaaggaaagagcactcagccaaattaatgcaagtgat
accttggatgcattgaatgaaatcagagtgaatttcttaggtaagaagggagaattgacc
tctgttttaaaatcaatgaaggatgtggcaccagaagatcgtccaaaagttggtcagtta
gtgaatgaagcaagagaaagtttggaggaagcactagagagtaagaaggaagcatttgga
aaagtgcttcgtgaagcaaagatgaaggcagagacaatcgacgttacacttcctgcaaag
aagcctatgcttggtcatcgtcatccaaatacgattgcattagaggaagcagagcgtatc
ttcgttggtatgggctatgaagtagtagaaggtccagaaattgagtatgattattataac
tttgaagcacttaatattccagcgaaccatccagcaaaagatgagcaagatactttctat
gttacaagcaatatcttacttcgtacacagacttctccagttcaggtacatgtaatggag
cagggaaaacttccaatccgtatgattgcaccaggtagagtattccgttctgatgaagtg
gatgcgacacattctccaagtttccaccagattgaaggattagtaatcgataagaatatc
acatttgcagatttaaaaggaaccttagctgaatttgcaaagcagttgtttggagaagag
acaaaggttaaattcagacctcatcatttcccatttacagagcctagcgctgaagtggat
gtatcttgtttcaaatgtgggggaaagggatgtcgtttctgtaagggttctggctggatt
gaaatcttaggatgtggtatggttcacccacgagttcttgaaatgagcggaattgatcca
gaagagtatacaggatttgctttcggagtaggtcttgagcgtatcgcattactcaaatat
gaaatagatgatatgagacttctgtatgagaacgatatgagattcttaaagcagttctag

DBGET integrated database retrieval system