KEGG   Lachnoclostridium phytofermentans: Cphy_3842Help
Entry
Cphy_3842         CDS       T00619                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
cpy00260  Glycine, serine and threonine metabolism
cpy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpy01100  Metabolic pathways
cpy01110  Biosynthesis of secondary metabolites
cpy01130  Biosynthesis of antibiotics
cpy01230  Biosynthesis of amino acids
Module
cpy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cphy_3842
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cphy_3842
Enzymes [BR:cpy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cphy_3842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA UXS1_N
Motif
Other DBs
NCBI-ProteinID: ABX44189
UniProt: A9KL40
Position
complement(4706458..4707231)
Genome map
AA seq 257 aa AA seqDB search
MTRIEQAFTKGKALITFITGGDPGIEVTEELIVSMAMEGADLIEIGIPFSDPIAEGPIIQ
EANERALKAGATTDLLFDMIGRVRSKVLVPLVFMTYINPIYTYGADRFLRRCKEVGIDGV
IVPDLPYEEKEELLPLCKLHDITLISMIAPTSKERIQTILKEAEGFLYCVSSLGVTGVRT
EIGSQVDYMIKEAKKVTDIPCAVGFGISTPEQAREMAEISDGVIVGSAIVDIIAKHQEQC
VQPVTDFIKVLKKSICK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactaggatagaacaagcatttacgaagggaaaggcacttattacctttattacaggt
ggagatccaggaattgaagtcacagaagaattgattgttagtatggcaatggagggagcg
gacctaattgagataggaatcccattttctgatccgattgcggaaggccctattatccag
gaggcaaatgaaagagcattaaaggcgggggcaaccacagatttgctgtttgatatgata
ggaagggtaaggagcaaggtattggtaccattagtgtttatgacttatataaaccctatc
tatacctacggtgcagatcgatttttaaggcgttgcaaagaagttggtatcgatggagta
attgtacctgaccttccttatgaagaaaaggaagagctacttcctctttgtaaattacat
gatattacattaatatcgatgatagcaccaacctcaaaggaaagaattcaaaccatacta
aaggaagcagaaggtttcttatactgcgtttcttctcttggggtaaccggagtaagaaca
gagataggaagtcaagtggattacatgataaaagaggcgaagaaggtaaccgatattcct
tgtgcagttgggtttggaatttctacaccagaacaagcaagggagatggcagagatatcc
gatggtgtaattgtcggcagcgcaattgtagatattattgcaaagcatcaagagcagtgt
gttcagccagtgactgattttatcaaagtattaaagaaatcaatttgtaagtaa

DBGET integrated database retrieval system