KEGG   Lachnoclostridium phytofermentans: Cphy_3845Help
Entry
Cphy_3845         CDS       T00619                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
cpy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpy01100  Metabolic pathways
cpy01110  Biosynthesis of secondary metabolites
cpy01130  Biosynthesis of antibiotics
cpy01230  Biosynthesis of amino acids
Module
cpy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cphy_3845
Enzymes [BR:cpy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cphy_3845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE ThiG QRPTase_C His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABX44192
UniProt: A9KL43
Position
complement(4709206..4710021)
Genome map
AA seq 271 aa AA seqDB search
MILEKIVETTKDRINQEKRRLPEEVIKKSATEMAIKQGFGSSSSISRDKFFFEEVMSRPG
VNFLCEIKRASPSKGMIAKDFDPVFIAKEYEEGGAAAISVLTEPTFFLGKDDYLMEVKKE
VGIPVLRKDFILEAYQIYQAKLLGADCVLLIVSILTEEQLTGFLKICDELGLSALVETHN
QEEVMRALQCGARIIGVNNRNLSTFEVSIENSLKLRTLVPKEAIFIAESGISTPEQIKEL
KEAGVNGVLIGETLMKASNKKLMIRNLKSLL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgattttagaaaaaatagtagaaacaacaaaagatagaatcaatcaagaaaagcgaaga
cttccggaagaagttataaaaaagagcgcaaccgagatggctatcaagcaaggatttggt
agttcttcttccatatcacgagacaaatttttttttgaagaagtcatgagtagaccgggt
gttaattttctttgtgagattaaaagggcatctccttcaaaaggtatgatagcaaaggat
tttgatccagtattcatagccaaagagtatgaagaaggcggtgctgctgcaatttcagtg
cttacggaacccaccttttttcttggaaaggatgattacctgatggaggtaaaaaaagaa
gtaggtattcctgtactacgaaaagactttatcctagaagcttatcagatttaccaagcg
aaactacttggtgcggattgtgtcttactcatagtatccatcttaacagaggagcagtta
accggatttctgaaaatctgcgatgaactggggctaagtgcattagtggaaactcataac
caagaggaagtaatgagggctcttcaatgtggagcaagaataatcggtgtgaataatcga
aatttatcaacctttgaggtatcaattgaaaatagtttaaagttacgtacgcttgttcca
aaggaggctatctttattgcagaaagcgggatttctacaccagagcagataaaagagctt
aaggaagcgggtgtaaacggagttctaatcggtgagacgctaatgaaagcatcaaataaa
aaactaatgatacgaaatcttaaaagtctactttag

DBGET integrated database retrieval system