KEGG   Lachnoclostridium phytofermentans: Cphy_3853Help
Entry
Cphy_3853         CDS       T00619                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
cpy00010  Glycolysis / Gluconeogenesis
cpy00020  Citrate cycle (TCA cycle)
cpy00620  Pyruvate metabolism
cpy01100  Metabolic pathways
cpy01110  Biosynthesis of secondary metabolites
cpy01120  Microbial metabolism in diverse environments
cpy01130  Biosynthesis of antibiotics
cpy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cphy_3853
   00020 Citrate cycle (TCA cycle)
    Cphy_3853
   00620 Pyruvate metabolism
    Cphy_3853
Enzymes [BR:cpy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     Cphy_3853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP DUF4914
Motif
Other DBs
NCBI-ProteinID: ABX44200
UniProt: A9KL51
Position
4721888..4723555
Genome map
AA seq 555 aa AA seqDB search
MSTKAYYKRDEIGVGKPGFSKTRSIIEAAFYGNNVVKVNTLKEAYELAKNSPGTVVTDMP
VYRGEEFGLEKDSKVLLFNDGSITGRYAAARRIAGEPNVDCAELDKIVMDAIYDTRWDTM
YHAEVYIGLDPEFMIKAHLLIPEGEENIMYSWMLNFQYMSDEYVRMYKDSKPIGNEPDIY
IFSNPQWTGTTNPNYDPKCLCYFNTAENCAAILGMRYFGEHKKGTLTIGWAIANRNGYAS
CHGGQKRYNLPNNKSYVASVFGLSGSGKSTITHAKHDSKYDITVLHDDAFIINTETGSSI
AMEPTYFDKTADYPTYCEDNKYLLTAQNCSATIDEDGKIVLVTEDIRNGNGRAIKSKLWS
PNRVDKIEEPVNAIFWIMKDPTIPPIVKLKGASLASVMGATLATKRSNAERLAEGIDPKA
LVVEPYANPFRTYPLANDYDKFKKLVAERNVDCYIINTGDFMGKKVKPADTLGVIEAVVE
GNAEFKQWGPFEDIEIFEWDGFIPNLDDPEYKSQLKARMLDRVKFVESRENFKGGYDKLP
EDALLALKKVVSGLN
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaaaagcgtattataagcgcgatgaaatcggtgttggaaagccaggattctca
aaaactcgctctatcattgaagccgctttttatggcaacaatgtagtgaaagtcaacacc
ctaaaggaagcctacgagcttgcgaaaaattctcctggtactgtggtaactgatatgcca
gtatacagaggagaagaattcggtctagaaaaagactcaaaagtactcttatttaatgat
ggttctattaccggacgttatgctgctgcaagaagaatcgccggtgagccaaatgttgat
tgcgcggaattagacaaaatcgttatggatgctatttatgacactagatgggataccatg
taccatgcagaagtttacataggcttagatcctgaatttatgataaaagcccatctgtta
attccagaaggtgaagagaacattatgtactcctggatgttaaactttcaatacatgtca
gatgaatatgtaaggatgtacaaagattcgaaacctattggtaatgaaccagatatctat
attttctcaaatccacaatggaccggaacaacaaatcctaactatgatcctaaatgctta
tgctattttaatactgctgaaaactgtgccgctatcttaggtatgagatactttggagag
cacaaaaaaggaactctcacgattggatgggctatcgctaaccgaaatggatatgcctct
tgccatggtggacaaaaaagatacaaccttccgaataacaaatcctatgttgcatccgta
ttcggtctttcaggctcaggaaagtctacaataacacatgcaaaacatgatagtaagtat
gacataaccgtacttcatgatgatgcatttatcattaatacagagacaggatcatcgatc
gcgatggagcctacttatttcgataaaactgctgattaccctacatactgcgaagataat
aaatatctgttaacagctcaaaactgctccgctaccattgatgaggatggtaagatagtt
ctggtaacagaggatatccgtaatggtaatggtcgtgccataaaatcaaaattatggtca
ccgaaccgcgttgataaaatagaagagccagtaaatgcaatcttctggattatgaaagat
cctactatcccaccgatagtaaaattaaaaggcgcttcgcttgcttctgttatgggtgca
accttggcaacaaaaagatcaaatgcagaaagattagcagaagggatcgaccctaaagca
ttagtagtagaaccatatgcaaatccatttagaacttatcctttagcaaatgattatgat
aagttcaaaaagttagtagctgagagaaatgtagattgttatattatcaatactggtgac
ttcatgggtaaaaaggtaaaaccagcagacacacttggtgttatagaggcagttgtcgaa
ggtaatgctgaatttaaacaatggggaccttttgaagatattgaaatctttgagtgggat
ggatttattccaaatctagatgacccagaatataaatctcagttaaaagctagaatgcta
gaccgtgttaaatttgttgaaagtagagaaaactttaagggtggatatgataaacttcca
gaagatgctcttttggctcttaaaaaggtagtatctgggttgaactaa

DBGET integrated database retrieval system