KEGG   Lachnoclostridium phytofermentans: Cphy_3925Help
Entry
Cphy_3925         CDS       T00619                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cpy  Lachnoclostridium phytofermentans
Pathway
cpy00010  Glycolysis / Gluconeogenesis
cpy00071  Fatty acid degradation
cpy00350  Tyrosine metabolism
cpy00620  Pyruvate metabolism
cpy00625  Chloroalkane and chloroalkene degradation
cpy00626  Naphthalene degradation
cpy00650  Butanoate metabolism
cpy01100  Metabolic pathways
cpy01110  Biosynthesis of secondary metabolites
cpy01120  Microbial metabolism in diverse environments
cpy01130  Biosynthesis of antibiotics
cpy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cpy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cphy_3925
   00620 Pyruvate metabolism
    Cphy_3925
   00650 Butanoate metabolism
    Cphy_3925
  Lipid metabolism
   00071 Fatty acid degradation
    Cphy_3925
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cphy_3925
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cphy_3925
   00626 Naphthalene degradation
    Cphy_3925
Enzymes [BR:cpy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cphy_3925
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Cphy_3925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABX44272
UniProt: A9KLW3
Position
4821675..4824293
Genome map
AA seq 872 aa AA seqDB search
MTKKVELQTTGLVDSLEALTAKFRELKEAQELFATYTQEQVDKIFFAAAMAANQQRIPLA
KMAVEETGMGIVEDKVIKNHYAAEYIYNAYKDTKTCGVVEEDPSFGIKKIAEPIGVVAAV
IPTTNPTSTAIFKTLLCLKTRNAIIISPHPRAKNCTIAAAKVVLDAAVAAGAPAGIIGWI
DVPSLELTNEVMKNADIILATGGPGMVKAAYSSGKPALGVGAGNTPVIMDESCDVRLAVS
SIIHSKTFDNGMICASEQSVIISDKIYEAAKKEFKDRGCHICSPEETQKLRETILINGAL
NAKIVGQSAHTIAKLAGFDVAEAAKILIGEVESVELEEQFAHEKLSPVLAMYKSKSFDDA
VSKAARLVADGGYGHTSSIYINVGTGQEKIAKFSDAMKTCRILVNTPSSHGGIGDLYNFK
LAPSLTLGCGSWGGNSVSENVGVKHLINIKTVAERRENMLWFRAPEKVYFKKGCLPVALA
ELKDVMNKKKVFIVTDAFLYKNGYTKCVTDQLDAMGIQHTTYYDVAPDPSLASATEGAEA
MRLFEPDCIIALGGGSAMDAGKIMWVMYEHPEVNFLDLAMRFMDIRKRVYSFPKMGEKAY
FIAVPTSSGTGSEVTPFAVITDERTGVKYPLADYELLPKMAIIDADMMMNQPKGLTSASG
IDALTHALEAYASIMATDYTDGLALKAMKNIFAYLPSAYENGAADPVAREKMADASTLAG
MAFANAFLGICHSMAHKLGAFHHLPHGVANALLINEVMRFNSVSIPTKMGTFSQYQYPHA
LDRYVECANFLGIAGKNDNEKFENLLKAIDELKEKVGIKKSIKEYGVDEKYFLDTLDAMV
EQAFDDQCTGANPRYPLMKEIKEIYLKVYYGK
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaaaagtggaattacagacaactggattagtagactctctcgaagcattaaca
gcaaaatttagagagttaaaagaagcacaagagctctttgctacctacactcaagagcaa
gtagataaaatcttctttgctgctgccatggctgccaatcagcaacgtattccgttagca
aagatggctgtagaagaaacgggtatgggtattgtagaagataaagtaattaagaatcat
tatgctgcagagtatatttacaatgcatacaaagatacaaaaacatgtggagtggttgaa
gaagatcctagcttcggtatcaaaaaaattgcagagccaatcggcgtagttgcagctgta
atcccaactaccaatcctacctccactgctatctttaaaacattactttgtttaaagact
cgtaacgcaatcatcatcagcccacatcctcgtgctaagaactgtaccatcgcagctgct
aaggtagttttagatgctgcagttgctgcaggtgctcctgctggtataattggatggatt
gatgttccatcacttgaattaaccaatgaagttatgaaaaatgcagacatcatccttgca
actggtggacctggtatggtaaaggctgcttattcttctggtaaaccagcacttggtgtt
ggcgcaggtaatacccctgttattatggatgaaagctgcgatgttcgccttgcagtaagc
tctattattcactctaagacatttgataacggtatgatttgtgcttccgagcaatccgta
attattagtgataagatttatgaagctgctaagaaagaattcaaggatcgtggttgccac
atctgctccccagaagagactcagaagcttcgtgaaacaatcctaattaatggtgctctt
aacgctaaaattgttggacaaagcgctcatacgattgcaaagcttgcaggatttgatgta
gcagaagctgctaagattttaattggtgaagtagaatccgttgaactagaagaacaattt
gcacacgagaaactttctccagttcttgctatgtacaaatcaaaatcctttgatgatgca
gtaagcaaagctgctcgtcttgttgcagatggcggttatggccatacttcttccatctat
attaatgtaggtaccggacaagaaaagattgcaaagttttctgatgctatgaagacttgc
cgtattcttgtaaatacaccatcctcccatggtggtatcggtgacctttataactttaaa
ttagctccatctcttactcttggttgtggctcctggggcggtaactctgtatcagaaaac
gtaggagtaaagcacttaatcaacattaagacagttgctgagaggagagaaaacatgctt
tggtttagagcacctgagaaagtatactttaagaagggttgtttaccagtagccctcgca
gaattaaaagatgtaatgaataaaaagaaagtattcattgtaaccgatgctttcctttat
aaaaatggctatacaaaatgtgttactgatcagttagatgctatgggaattcagcatact
acttactatgatgttgctccagatccatctttagctagtgctacagaaggtgcagaagcg
atgagactcttcgagccagactgtattatcgcactcggtggtggttctgcaatggatgcc
ggaaagattatgtgggttatgtatgaacaccctgaagtaaacttccttgaccttgcaatg
cgtttcatggatattagaaagcgtgtttactccttccctaagatgggcgaaaaagcttac
tttatcgcagttccaacttcctccggtactggttctgaagttacaccatttgctgttatt
accgatgagagaactggcgtaaaatatccacttgcagattacgaattacttcctaagatg
gctattattgatgccgatatgatgatgaatcaacctaagggattaacttctgcttccggt
attgatgcccttacccatgcattagaggcatatgcttctatcatggctactgactatacg
gatggtttagcattaaaagctatgaagaatatcttcgcttaccttccaagcgcatatgaa
aatggtgccgctgatccggttgcaagagaaaagatggcagatgcttctaccttagctggt
atggcattcgcaaatgcattcttaggaatttgccactccatggctcataaattaggtgca
ttccaccacttaccacacggtgtagcaaacgcactcttaatcaacgaagtaatgcgcttt
aactccgttagcattcctacaaagatgggtactttctctcaataccaatacccacatgcg
ttagatcgttatgtagaatgtgcgaacttcttaggtattgccggaaagaacgacaatgag
aaattcgaaaaccttcttaaggcaattgatgaattaaaagaaaaagttggtatcaagaaa
tccatcaaagaatatggcgtagacgagaaatatttcttagatactttagatgctatggtt
gaacaggctttcgatgatcagtgtactggtgctaacccaagatatccattaatgaaggaa
atcaaggaaatctatcttaaagtgtactacggtaaataa

DBGET integrated database retrieval system