KEGG   Corynebacterium pseudotuberculosis PAT10: CpPAT10_0611Help
Entry
CpPAT10_0611      CDS       T01879                                 

Gene name
echA6
Definition
(GenBank) Enoyl-CoA hydratase echA6
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cpz  Corynebacterium pseudotuberculosis PAT10
Pathway
cpz00071  Fatty acid degradation
cpz00280  Valine, leucine and isoleucine degradation
cpz00310  Lysine degradation
cpz00360  Phenylalanine metabolism
cpz00380  Tryptophan metabolism
cpz00410  beta-Alanine metabolism
cpz00627  Aminobenzoate degradation
cpz00640  Propanoate metabolism
cpz00650  Butanoate metabolism
cpz00903  Limonene and pinene degradation
cpz01100  Metabolic pathways
cpz01110  Biosynthesis of secondary metabolites
cpz01120  Microbial metabolism in diverse environments
cpz01130  Biosynthesis of antibiotics
cpz01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cpz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CpPAT10_0611 (echA6)
   00650 Butanoate metabolism
    CpPAT10_0611 (echA6)
  Lipid metabolism
   00071 Fatty acid degradation
    CpPAT10_0611 (echA6)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CpPAT10_0611 (echA6)
   00310 Lysine degradation
    CpPAT10_0611 (echA6)
   00360 Phenylalanine metabolism
    CpPAT10_0611 (echA6)
   00380 Tryptophan metabolism
    CpPAT10_0611 (echA6)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CpPAT10_0611 (echA6)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CpPAT10_0611 (echA6)
   00281 Geraniol degradation
    CpPAT10_0611 (echA6)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CpPAT10_0611 (echA6)
   00627 Aminobenzoate degradation
    CpPAT10_0611 (echA6)
   00930 Caprolactam degradation
    CpPAT10_0611 (echA6)
Enzymes [BR:cpz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CpPAT10_0611 (echA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEK91946
Position
647152..647838
Genome map
AA seq 228 aa AA seqDB search
MFEQTRDDDASRALKEIETVKVSSDGFVRHIVLDRDDRRNALSGDMCRAIAHAVTEASAA
AVDNASVRAIMISGVGRAFCAGADLGSSVREGGEHSSDGAVYGAGFHDALFAMLHSIIQA
EVPIIANVQGAAVGAGMQLALACDLRVVGESAWFKVPAVSLGFALDGWTIGRAQKLCGGA
FARNLLLAGASLTPDAALSSGFVAIRGDHAAAVAFAHEVAGLASLSVR
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgaacaaactcgagacgatgatgcctcgcgggctttgaaagagatagaaactgtc
aaggtatcctccgatggttttgtgcgtcatatcgttttggatagagatgatcgccggaac
gctctttcgggtgatatgtgccgagctatcgcacacgccgtgactgaagcttctgctgcg
gccgtcgataatgcatcagtgcgtgcgatcatgattagcggagtaggacgagccttttgc
gcaggtgctgatctggggtcgtctgtgcgagaaggtggggaacattcctcggatggggcg
gtgtatggcgccggtttccatgatgcgctctttgctatgttgcattcgattattcaggca
gaggtgccgataatagctaatgtgcaaggggctgcggtaggtgctgggatgcagcttgct
ttggcgtgtgatctccgtgttgttggagagtctgcatggtttaaagtccccgctgtttct
ttggggtttgcgctggatggatggactatagggcgtgctcaaaaactctgtggcggtgct
tttgctaggaatttgttgcttgccggtgcatcattgaccccggatgcggctctgtctagt
ggttttgttgcaatccggggcgaccatgctgcagcagttgcttttgctcatgaagttgcc
ggattggcgtctctttctgtacggtag

DBGET integrated database retrieval system