KEGG   Corynebacterium pseudotuberculosis PAT10: CpPAT10_0721Help
Entry
CpPAT10_0721      CDS       T01879                                 

Gene name
mca
Definition
(GenBank) Mycothiol conjugate amidase Mca
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
cpz  Corynebacterium pseudotuberculosis PAT10
Brite
KEGG Orthology (KO) [BR:cpz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CpPAT10_0721 (mca)
Enzymes [BR:cpz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     CpPAT10_0721 (mca)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: AEK92055
Position
766293..767159
Genome map
AA seq 288 aa AA seqDB search
MRRLRLLAIHAHPDDEASKGAATMAKYAAEGCDVLVLTCTGGERGDILNPAMDKPGILEN
MAQVRRQEMAESIRALGAQHRWLGYVDSGLPEGDPLPALPPGCFALADTEEATDKVVAVI
REFQPHVIITYDENGGYPHPDHLKVHEVSMRAWDLSGQASYKPELGAAWNPLKLYYTHGF
IRQRMQMFHNLLIQEGKESPYVDMLERWQVHRADIMARVTTQIRCDDYFEHATQIDPAGA
FFGTPVADQRRLWPTEEFELARTRVTTAIPEDDLFAGIDASYKKIERV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaggctaagactccttgccatacatgctcatcctgatgatgaggccagcaaaggt
gctgcgacaatggcaaagtacgccgctgaggggtgcgacgtactcgttttaacctgcact
ggtggtgagaggggagacatcctcaatccagctatggacaagccaggaatcttagaaaat
atggcgcaggtgcgcagacaggagatggctgagtcgattcgcgccttaggcgctcaacac
cgttggttgggctatgtggactcaggtttgccggagggagacccactgcctgcactgccg
ccaggctgctttgctcttgctgataccgaggaagcaacagataaggttgttgcggtgatt
cgagaattccagccgcacgtgatcattacttatgatgaaaatggcggttatcctcatcca
gatcatctcaaagtccatgaagtatctatgcgtgcatgggatctttcagggcaagcttcc
tataagccggagcttggggcggcgtggaatccgctcaagctgtattacacgcacggcttt
atccgtcaacgcatgcagatgtttcacaatttgctgattcaggaggggaaagaaagtccg
tatgtggatatgctcgagcgatggcaggttcatcgggcggacattatggcgcgagtaacc
actcaaattcgatgcgacgattattttgagcatgctacgcagatcgaccccgcaggggct
ttctttggcactccggtggcagatcagcggcgtttatggcctacggaggaatttgagttg
gcaaggacacgagtgaccactgctatcccagaggatgatcttttcgctggaatcgacgcg
tcatataaaaagattgagcgtgtttaa

DBGET integrated database retrieval system