KEGG   Corynebacterium pseudotuberculosis PAT10: CpPAT10_1024Help
Entry
CpPAT10_1024      CDS       T01879                                 

Gene name
cobL
Definition
(GenBank) Precorrin-6Y C5,15-methyltransferase
  KO
K00595  precorrin-6Y C5,15-methyltransferase (decarboxylating) [EC:2.1.1.132]
Organism
cpz  Corynebacterium pseudotuberculosis PAT10
Pathway
cpz00860  Porphyrin and chlorophyll metabolism
cpz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CpPAT10_1024 (cobL)
Enzymes [BR:cpz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.132  precorrin-6B C5,15-methyltransferase (decarboxylating)
     CpPAT10_1024 (cobL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase Methyltransf_2 Methyltransf_25 PCMT MTS
Motif
Other DBs
NCBI-ProteinID: AEK92359
Position
complement(1112643..1113911)
Genome map
AA seq 422 aa AA seqDB search
MSREATSLRRIAVGDSVAKTGFITVVGISAGGVDELGTQAREALYQADIIIGSWRQLGLV
PEDVSAERRPWPSPMLPKIPEIFAELTDLNVVVLGSGDPMFHGIGSTLIRLLPQHSVTVI
PHSSSASLACARLGWPLDKTPVYSLVTNAVDHLVLPIQRGGIFLVLGQDEKTPASICDLL
VELNQSDAKIIILSDLGSSDEVVVSGTAEQPPTATSSLNVIAVSLQRKGESMLPGLADAH
YISDGQLTKRHIRALTLSTLAPRQGETLWDIGGGSGSIAIEWLRSTPGTTAVCFEVVEER
RNRIAKNARSLGVIDRLTILHGAPDSFDEVPTPPDAMFIGGGLTAPGVFDAAWSRLPMGG
RLVANAVTIESESVLWELRKTLGGSMARFDISQEHNVGSFTTMKPALPVLQWSVTKSNTP
KL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagtagggaagcgacctcgttacgacgcattgcggtaggggattcagtggccaaaact
ggttttatcactgtggtaggtattagcgcgggtggagtagacgagttagggacccaggcg
cgtgaagcactctaccaggcggacatcatcattggttcttggcgtcagctaggactcgtc
cccgaggatgtctcagcggaacgtcgcccgtggccgtctccgatgcttcccaaaatccca
gaaatttttgcagagctgacagatcttaatgtagtggtgttaggctcaggcgatccgatg
ttccatggcatcgggtcaacgctcatacggttgcttccgcagcattcggttacagtgatt
ccacatagctcctcagcatccttggcatgcgcgcgtctaggctggccccttgataagact
cccgtttatagcttggtcaccaacgctgtagatcatctagtacttccaatacaacgcggg
ggaattttcctggtgctcggtcaggatgaaaaaactcctgcttctatctgtgacctgtta
gttgagctcaatcaatcagacgcaaaaataataatactcagcgatttgggcagctctgat
gaggtagttgtttcaggcacggcagagcagccgcctacggctacgagctccctcaacgtt
atcgctgtgtccctgcagcgcaaaggcgagagtatgcttccggggcttgccgacgctcac
tatatctccgatggacagctcactaaacgccatattcgtgcccttacgctatcgactttg
gccccacgccaaggcgaaacgttatgggacataggtggtggttctggttctatcgctatt
gagtggctgagatccacacctggaacaacggctgtgtgctttgaagtcgttgaggaacgc
cgcaaccgcatcgcaaaaaatgcacggtcgttaggagttatagaccgcttaaccatcctt
catggagctcctgactctttcgatgaggtccctacgcctccagatgccatgttcatcgga
ggcggcctcacggcgcctggggtctttgacgctgcatggtctaggcttccgatgggtggc
cgtcttgtggctaacgcagtgacaatagaaagtgaatcggtgctctgggagttaagaaaa
acactgggtggaagcatggcccgcttcgatatttcgcaggaacataacgtgggatctttt
accacaatgaagccagcactgcctgtgctccagtggagtgttaccaagtccaacacccct
aaactttag

DBGET integrated database retrieval system