KEGG   Corynebacterium pseudotuberculosis PAT10: CpPAT10_1294Help
Entry
CpPAT10_1294      CDS       T01879                                 

Gene name
cobQ
Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
cpz  Corynebacterium pseudotuberculosis PAT10
Pathway
cpz00860  Porphyrin and chlorophyll metabolism
cpz01100  Metabolic pathways
Module
cpz_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:cpz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CpPAT10_1294 (cobQ)
Enzymes [BR:cpz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     CpPAT10_1294 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 GATase CbiA SNO GATase_5 Peptidase_C26 Peptidase_S51
Motif
Other DBs
NCBI-ProteinID: AEK92631
Position
complement(1415819..1417144)
Genome map
AA seq 441 aa AA seqDB search
MSNNSAVTPDGGEIGRAQALQACACGLAPSTAFNPILLKPGSDRTSQLVVNGKAAGNVSA
RNYIEYRAQLRTVAAEALNALRSEYEVVICEGAGSPAEINLRETDVANFGLAEACDLPVY
LVGDIDRGGVLAHFFGTHQIVSEQDRARITGFIVNKFRGDQSILEPGLDDLEKRLGVPTV
AVLPFIKGLWIDAEDSLQTHIGSTVGPASPALGAQRLRVAAVRLPRVSNATDVEALACEP
GVTVSWTVDPDQVHEADVVILPGSKATVSDLNWSRRTGIAEAIIERARQEAPVLGICGGF
QMMCASIHDPVESGTHKPVQGLGIFDIDIAFHPEKTLIRHDHGGYEVHHGRVMRSTETPW
IGEEGAVKGACFGTHRHGYLESDPARREFLRRIVALTGRTGFVLDPKTSFQGERDKQLDL
LADSIEKHWDIDALIRDLSSA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaataactcggcggtgacacccgatggcggcgagataggacgagcgcaagcacta
caagcttgtgcctgtgggctcgctcccagcacggcttttaatccgattttgttaaaaccg
gggtcagaccggacctcacagcttgtggtgaatggtaaagctgccggcaacgtgagcgcc
cgcaactatatcgagtatcgcgctcagctaaggaccgtagctgcagaggctcttaacgca
ttacgctcggaatatgaagttgtgatttgcgagggagcagggtcgcctgcagagataaac
ctcagggaaacggacgttgcaaattttgggttagctgaagcttgtgatcttccggtctat
ttggtgggggatatagatcggggcggagttttagctcatttttttggtactcatcagatt
gtttccgagcaagatcgagcacgaatcacagggtttattgttaataaattccggggggat
caatcgatccttgaaccagggctagatgatctagaaaaacggcttggagtgcccactgtc
gctgttttgccctttatcaaaggactatggatagatgcggaagattctctccaaacacat
atagggtccactgttggtcccgcttctccggctcttggcgcgcagcgtttgcgggtggcg
gcggtgaggcttccgcgagtatccaatgccactgatgtagaagctttggcatgtgaaccg
ggggtgacggtttcttggactgtggatcctgaccaagttcatgaggcagatgtggtgata
ctacctggttcaaaagcgaccgtaagtgatttgaactggtcaagacgcacggggatcgca
gaggccatcatagaaagagctcgccaagaagccccagttttaggcatctgcggtggtttt
cagatgatgtgtgcgagcattcatgatcccgtggaatctgggactcacaagcccgtacaa
ggcctaggaatctttgacattgatatagctttccatccggaaaaaaccttaataagacac
gatcatggcggttatgaggtccaccacggccgagttatgcgttctaccgaaaccccgtgg
ataggggaggagggggcggttaagggcgcatgttttggcacacaccggcatgggtatctc
gaatcggatccagcgcgtagagaatttttgcgacgcatcgttgcgttgacgggacgaacg
ggctttgtgcttgatcccaaaacgtcttttcagggtgagcgagacaaacaactcgatcta
ctagcagatagtattgagaagcattgggatattgatgctttaatccgtgatctttctagt
gcgtag

DBGET integrated database retrieval system