KEGG   Corynebacterium pseudotuberculosis PAT10: CpPAT10_1413Help
Entry
CpPAT10_1413      CDS       T01879                                 

Gene name
glk
Definition
(GenBank) Glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cpz  Corynebacterium pseudotuberculosis PAT10
Pathway
cpz00010  Glycolysis / Gluconeogenesis
cpz00052  Galactose metabolism
cpz00500  Starch and sucrose metabolism
cpz00520  Amino sugar and nucleotide sugar metabolism
cpz00521  Streptomycin biosynthesis
cpz01100  Metabolic pathways
cpz01110  Biosynthesis of secondary metabolites
cpz01120  Microbial metabolism in diverse environments
cpz01130  Biosynthesis of antibiotics
cpz01200  Carbon metabolism
Module
cpz_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpPAT10_1413 (glk)
   00052 Galactose metabolism
    CpPAT10_1413 (glk)
   00500 Starch and sucrose metabolism
    CpPAT10_1413 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CpPAT10_1413 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CpPAT10_1413 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CpPAT10_1413 (glk)
Enzymes [BR:cpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CpPAT10_1413 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase TCR FGGY_N DEDD_Tnp_IS110 Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: AEK92746
Position
complement(1553572..1554525)
Genome map
AA seq 317 aa AA seqDB search
MSERSDAVTVGFDIGGTNMRAAAVTSDGQIIDSMSVPTPSTPELLESGIIGLVDNLKQKH
EVSAVGLAVAGFLDPDCEVVRFAPHLPWRDRHVRAELSDALGLPVRLEHDANSAAWGEYR
FGAAQGADNWVLFAVGTGIGATLMHQGEIYRGAFGTAPEFGHLTVVPGGRTCSCGKRGCL
ERYCSGTALETTAREMIAAGKATESVLIDYLADGSLSGKRIMAAASDGDQLACAVVEDFA
QWMGRALSVVADVLDPGLIVIGGGVSTASALYIDTAVETMAASMVGAGYRPLPTVSCAKL
GGDAGMIGVSDLARQLV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaagatccgacgcagtcaccgtgggctttgatattggtggcactaacatgcgg
gcggcggcggtgacttcggatggtcagattattgactctatgtcggttcctacgccatca
actcctgaattacttgaatcgggcatcatcgggttggtggataacctgaagcaaaaacac
gaggtttccgcagtaggcctcgccgtagctggcttcttggatcctgattgtgaggtcgtt
cgttttgctccacaccttccgtggagagaccggcatgtccgtgcagaactttcagatgct
ttagggctacctgtccggcttgagcacgatgcaaattctgctgcatggggagaatatcgg
tttggtgccgctcagggggcagataactgggttctttttgccgtgggaacgggaattggt
gcaacccttatgcatcaaggagaaatttaccgtggggcttttggcacagcgccggaattc
gggcacctcactgtggtaccagggggacgaacatgttcctgcggtaaacgagggtgcctt
gaacgctactgttcgggaactgccctggaaactactgcccgcgagatgatcgcggcgggc
aaagcaacagagtccgtgcttatcgactatctagctgatggttccctgagcggtaagcgc
attatggccgcagctagcgacggtgatcagctggcttgcgctgtagttgaagattttgcg
caatggatggggcgagccctatccgtggttgccgatgtccttgatcccggtcttattgtg
attggtgggggcgtatccactgcaagcgcgctttatattgatactgctgtggagacaatg
gctgcatcgatggtgggggcaggataccgcccccttcccacagtttcgtgtgcgaagcta
ggcggagatgcgggtatgatcggggtatctgatttggctcgccaattggtttga

DBGET integrated database retrieval system