KEGG   Corynebacterium pseudotuberculosis PAT10: CpPAT10_2089Help
Entry
CpPAT10_2089      CDS       T01879                                 

Gene name
trpC
Definition
(GenBank) Bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cpz  Corynebacterium pseudotuberculosis PAT10
Pathway
cpz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpz01100  Metabolic pathways
cpz01110  Biosynthesis of secondary metabolites
cpz01130  Biosynthesis of antibiotics
cpz01230  Biosynthesis of amino acids
Module
cpz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpz00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CpPAT10_2089 (trpC)
Enzymes [BR:cpz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CpPAT10_2089 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CpPAT10_2089 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AEK93399
Position
2307792..2309057
Genome map
AA seq 421 aa AA seqDB search
MECKSASPSLGTIRTDYSPGDIARIYSRYASAISVLCEPDKFNGDYDHLATVAASTHLPV
LCKDFIVDPVQVQAARYFGADAVLLMLSVLDDATYLSLSSEAERLGLDVLTEVINEEEVK
RGIRLGAKIFGVNHRNLHDLSIDLSRSSQLEPLIPENAVLVSESGIKTNETVRQLAGHSD
AFLVGSQLTSHSNIDSASRSLVYGTNKVCGLTTASAAQNARAVGATHGGLIFEDSSPRNV
SRETAEKIIAAEPNLNYVAVSRRDHGWEEILLPEITSLQIHAPYQGSIAGERALIDNARR
ELQKAGREDVSIWRAVSMTLPEGAATATALTDDVDMLLLDAGIGGTGTSFNWEKITPDIA
PKAILAGGLNLDNLPEALKAGCAGLDLNSGFEYPSTAGSWSGMKDSGLLRQAFSKIRNFH
Y
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggaatgcaaatctgcatcaccatcattaggcacaatccgtaccgactattccccggga
gatattgcacgcatttattctcgatatgcttctgcaatttccgttctttgtgaacccgac
aagttcaacggcgactacgaccacttggccactgtcgcggcttccacgcatttgccggtc
ttatgcaaggactttatcgtcgaccctgtgcaggttcaggctgctcgttactttggcgcg
gacgcggtcttgctcatgcttagcgtgcttgacgacgccacctacctctcactttctagc
gaagccgaacgtctcggactcgatgtgctcaccgaagtaataaacgaagaagaagtaaaa
aggggtattcgtctcggggctaagatatttggcgttaatcaccgcaacctacacgatctc
agcatcgacctttcccgctcctcacagctagagcctctcattccagaaaacgccgtatta
gtatcagaatctggcatcaaaacaaatgagaccgttagacaactagctggacattccgac
gctttccttgtgggctcccagctcaccagccacagcaacattgactccgcctcccgttca
ctcgtttacggaaccaataaggtatgcggtctcaccacggcttccgcagcgcagaatgct
cgcgcagttggcgcaacacacggggggctaatttttgaagactctagcccccgcaatgtt
tcacgtgaaaccgccgaaaaaatcattgcagcggagcccaacctgaactacgttgcagtg
agcagacgcgaccatggatgggaggaaatacttcttccagaaattacgagtctccaaatc
catgccccataccagggatccatagcaggggagagggcgctcatcgataatgcccgtcgg
gagcttcaaaaagcgggaagggaagatgtctccatctggagagctgtgtccatgacactt
ccagagggagccgccaccgctaccgcactgacggatgacgtagatatgttgcttctcgac
gccggcattggaggcaccggaacatcgtttaattgggaaaaaatcacgccagatatagcc
cctaaagcgatcctggcaggaggtcttaacctcgacaatcttcctgaagctttaaaggca
ggatgtgccggcctggatctcaattctggtttcgagtacccatccaccgctgggtcatgg
tctgggatgaaagattccggattgctacggcaagcgttctccaagatccggaattttcat
tattag

DBGET integrated database retrieval system