KEGG   Chenopodium quinoa (quinoa): 110682738Help
Entry
110682738         CDS       T05764                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic-like
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00450  Selenocompound metabolism
cqi00970  Aminoacyl-tRNA biosynthesis
cqi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    110682738
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    110682738
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cqi01007]
    110682738
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cqi03016]
    110682738
Enzymes [BR:cqi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     110682738
Amino acid related enzymes [BR:cqi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   110682738
Transfer RNA biogenesis [BR:cqi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    110682738
 Prokaryotic type
   Other AARSs
    110682738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1
Motif
Other DBs
NCBI-GeneID: 110682738
NCBI-ProteinID: XP_021714754
Position
Unknown
AA seq 435 aa AA seqDB search
MEKFPVEDEQFSVGSAVVEKISVEGQRNVLVTSALPYVNNVPHLGNIVGLVLSARAILSA
NIFARFCRLRGYNVLFIGGYDKYGTTSEVRAASENLTPREIRGKYHPLHKEIYQWFDISF
GHFGRTSSSEHTAVSQQILNSLFHNNLLMDHTIQQLYCENCLKFLADSLVEGLCPECRVS
CKGDQCEECNAYFNARDLLNPVCKICQNSSLTLRSTDHLFLNLGSLQPNLRALSERFTFS
NQLAKKITEKLVGKENKIPPKCITRDLKWGVPVPIEKFKDKVMYVWFDAPLGYLSITKCH
TSKWELWWKNPHNVELHLFMGKDNVPFYSVHFPPYLIGTGESWTLPHSIHATHFLLYKAG
KFSKIRGIGVFGDEVKDTNIPVEVYRYYTTDILHFQSSDSNFSWDDLQVKLNGELADNLG
NFMNRVISFIAKPPW
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggagaagtttccagtagaagatgaacaattctctgttggatcagctgttgtggagaag
atttcggtagaagggcaacgcaacgtgttggtgacgagtgcgctcccttacgtgaacaac
gtacctcatttaggaaacattgtaggtttagtcctaagcgctagggccatattgagcgct
aatatatttgctaggttttgtcgtcttaggggctacaacgtcctcttcatcggcggttac
gataagtatggtacaaccagtgaggttcgggctgcttccgagaatctcacaccccgcgag
atccgcggcaagtaccatcccttacataaggagatttatcagtggttcgacattagcttt
ggtcattttggccgaacatcttcctcagaacacactgccgtttctcagcagatcctcaat
tcactctttcataataatctcttgatggaccatacaattcaacaattgtattgtgaaaat
tgcttaaaattcttggcggatagtctagttgaaggtctatgtcctgagtgtcgtgtgtct
tgtaaaggcgatcaatgtgaggaatgcaatgcatatttcaatgctcgagatttattaaac
cctgtatgcaagatatgtcagaattccagcttgacactccgttccacagaccatctgttt
ttaaacctaggttctctgcaacccaacctgcgtgccctttctgaaagatttaccttttca
aatcaactggcgaagaaaattactgagaaacttgtcggtaaagaaaacaaaatccctccg
aagtgcattactcgtgatcttaaatggggagttcccgttcctattgaaaaatttaaagac
aaggtgatgtatgtgtggtttgatgctcctcttggttatttgtctatcacaaagtgtcac
acatctaagtgggaattgtggtggaaaaatccacataatgtggagctacaccttttcatg
ggaaaagacaatgttcctttttattcggttcatttccctccatacttgattggcaccggg
gaaagttggacccttcctcattcaatacatgctactcattttctgttatacaaagcagga
aaattttccaagatcaggggtattggtgtttttggtgatgaagtgaaagacacgaatata
cctgtagaagtatatagatattatactactgatatattacattttcagtcatccgactca
aatttttcttgggacgatttgcaagtaaaacttaatggcgagcttgctgataatttgggc
aatttcatgaatcgtgtcatctcttttatcgccaaacccccctggtaa

DBGET integrated database retrieval system