KEGG   Chenopodium quinoa (quinoa): 110684260Help
Entry
110684260         CDS       T05764                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 3-like
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    110684260
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqi03032]
    110684260
   03036 Chromosome and associated proteins [BR:cqi03036]
    110684260
   03400 DNA repair and recombination proteins [BR:cqi03400]
    110684260
Enzymes [BR:cqi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     110684260
DNA replication proteins [BR:cqi03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     110684260
Chromosome and associated proteins [BR:cqi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    110684260
DNA repair and recombination proteins [BR:cqi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     110684260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PADR1 PARP_reg BRCT BRCT_2 WGR PTCB-BRCT BRCT_3 LIG3_BRCT
Motif
Other DBs
NCBI-GeneID: 110684260
NCBI-ProteinID: XP_021716389
Position
Unknown
AA seq 805 aa AA seqDB search
MKVETRSHVAHDHGTRKHKTHEHTDHRTAKKTKQEDENETNGKTNGKAVTSASSKEYEEF
CNATRENLSPDHMKAILQLNGQDPTGFDDSVVSRCQDLLYYGALLECKVCGGNLEFIGNS
YSCTGELSEWATCTYKTKNPPRKQDPIKLPESVLDSPVSDLLKKYQDPSQRHQKEIPHHA
DKPFTGMVICLSGRLSRTHQYWKQVIEKHGGKVANTAIGVTCLVVPPMERERGGSSKVSE
AVERGIPVVREAWLKDCIEKEELLPLEAYECVSDRSAYGKGIAWDKQDSSEEAIESLVAE
LKMYGKRGVYKDTMLQQQGGKILEKDGLLYNCGFSLCDQGRKINEIAITQLVTVPEKRLH
LYYKKGKVGDDPKAEERMEEWDSVDDAIKEFARLFEELTGNEFFPWETEKKFQKKPQKFH
VIDMDDGVEVRYGGLALRQLGTAAAHCKLDPVAANFMKVLCSQEIYRYALMELGLDSPDM
PIGMVTDLHLKRCEDALLQFIEDVKSQEQGGPKAEALWSEFSSKWFTLMHSTRPFIFKDF
EELADHAASPLETVRDINAASRLIGDMSGSTLDDPMYERYKKLGCKITALDKESEDYKMI
LNYLEKTYEPIKVGEVSYDVSVENILAVDLSSGPSYNEIKKLPNKVLLWCGTRSSNLLRH
LQKGFLPAICSLPVAGYMFGRAIVCSDAASEAARYGFTAIDRPEGFLVLAVASLGDEVIE
VKSPPEDTKSLEERKVGVKGLGRKKTDESEHFVWKDDIKVPCGKLVTASPEPKESILDFN
EYAVYDPNQVKISFLVAVKYIEKAE
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttgaaacgagatctcacgtagcgcacgaccacgggacaaggaaacataagacg
catgagcatacggatcatcggaccgcgaagaagacgaagcaagaggatgagaatgaaacc
aatgggaagacaaatggtaaagcagtaacatcagcgagttctaaggagtatgaagaattt
tgtaatgccaccagggagaatctatctcctgatcatatgaaggccattcttcagttgaat
ggccaagaccctactggtttcgatgactccgtcgtttctagatgccaagacctgttatat
tatggagcattgttggaatgtaaagtatgtggaggcaatttggagttcattggaaatagt
tactcttgcactggggaattaagtgaatgggccacttgcacctataagaccaaaaatcct
cccagaaaacaggaccctatcaagctgccggaatcggttcttgattccccggtttctgat
ttgctgaagaaatatcaagacccgagtcagcgccatcagaaggaaatacctcatcatgct
gataagcctttcacaggcatggtcatatgtttgtctggccggctttctcgaactcatcaa
tactggaagcaagtaattgagaaacatggaggcaaagtagccaacacagctattggtgta
acttgcctagttgttcctcccatggaaagggaacgcggtggctcatcgaaagtgtctgaa
gcagtagagaggggaataccggtggtacgagaagcatggttaaaggactgcatcgagaaa
gaagagctgctgcctttagaagcgtatgaatgtgtttcagatcgatctgcttatggcaaa
ggtattgcatgggacaaacaggattcaagtgaggaagccattgagtcccttgttgctgag
cttaaaatgtatggaaaaagaggtgtctacaaggacaccatgctgcagcaacaaggaggg
aagatcttggagaaagacggtttactttacaattgtggtttctctctttgtgaccaaggc
cgcaaaataaatgagatcgctataacccaactggtcaccgtacctgagaaaaggctacac
ctctattacaagaagggtaaggtaggggatgatcctaaggcagaggagaggatggaagaa
tgggatagtgtggatgatgcaataaaggaatttgcacgacttttcgaggaattgacagga
aatgagttttttccatgggaaactgaaaagaagtttcagaagaaaccacaaaagttccat
gttatagatatggacgatggagttgaggtgagatatggtgggttggctcttcggcaacta
ggaacagcagctgcacattgtaaacttgatcctgtggctgcaaattttatgaaggtttta
tgcagtcaagagatctatagatacgctttgatggagttgggtttggattcgcctgacatg
ccaataggaatggtcactgatttgcacttgaaaagatgtgaggatgctctcctgcaattt
atagaggatgtaaagtcacaggagcaaggaggaccaaaagctgaagcactctggtctgaa
tttagttcaaaatggtttacgctcatgcattctactaggcctttcatcttcaaggatttt
gaggaacttgcggatcatgctgcatctcctcttgagactgttagggacataaatgcagct
tcacgactaattggcgacatgagtggctcgacattggatgacccaatgtatgaacgttac
aagaagctcggatgcaagataactgctctagacaaagaatctgaagattataagatgatc
cttaactacttggaaaaaacctatgaaccaatcaaagttggtgaagttagttatgacgtt
tctgttgagaacattcttgctgttgatttgagttctggaccatcttataatgagataaag
aagttgccaaacaaagttctgctatggtgtggaactcgaagttcgaatctgttaagacat
ctgcagaaggggtttctccctgcaatctgttctcttcctgttgcaggctacatgttcggg
agggcaattgtatgttctgatgccgcttctgaagctgcaaggtatggattcacagcaatc
gacaggccagaaggattcctagtactagcagtagcatctctaggggacgaagtaattgaa
gttaagagccctccagaggatacaaagtccttggaggagaggaaggtaggagtgaaaggg
ttagggaggaagaaaaccgatgagtcggagcattttgtttggaaggatgatatcaaggta
ccctgtgggaaattagtcacagcatcacctgaaccaaaagaaagtattttggatttcaat
gagtatgctgtttatgatcctaaccaggttaagataagctttttggtggctgttaagtac
atagagaaggcagagtga

DBGET integrated database retrieval system