KEGG   Chenopodium quinoa (quinoa): 110686655Help
Entry
110686655         CDS       T05764                                 

Definition
(RefSeq) polyamine oxidase-like
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00330  Arginine and proline metabolism
cqi00410  beta-Alanine metabolism
cqi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    110686655
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110686655
Enzymes [BR:cqi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     110686655
    1.5.3.16  spermine oxidase
     110686655
    1.5.3.-  
     110686655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 GIDA Pyr_redox_3 FAD_binding_2 FAD_binding_3 Pyr_redox HI0933_like FAD_oxidored Thi4 Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 110686655
NCBI-ProteinID: XP_021718950
Position
Unknown
AA seq 508 aa AA seqDB search
MLYILHIEKYNLEKKKMKGEAMKFHLLIFMVFLVTLASAASSPSVIIVGAGMSGISAAKD
LHDQGVKDFIFLEATDRIGGRIHKTEFAGHAVEMGANWLHGVGGPRKNPMYEIAKEIKLR
SFYSDWNNISYNSYKQEGGRYSKEEVDAALDMAESNEDYAEELSERLSAKKGKDDDMSLL
AAERLNHREPKTPLEKMIDFYSFDGEQAESPRVTSLKHIIPRPEYTLFGENDYFVADSRG
FESIVHHIAKTYLTYTNDTLNDPRVIFNQVVKEVDYSNSGIVTVKTEDGNEYTAQAVILS
PSVGVLQSGLISFKPELPFWKRRAIAEFSLGIYTKIFLKFPKKFWPTGKGTEFFFYAHER
RGYYAFWQQLEMEYPGSNILMVTVTDDESKRVEAQPDEKTKAEAMEVLRKIFGDDIPDAT
EILIPRWYSDRFYKGTFSNWPVGYTIKKHNNLKAPVENVFFTGEHTHAQLFGYADGAYYA
GKRAANDVNKLLKKKKSPNLRSLYYWWM
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgttatatattctacatatagaaaaatataatttagaaaaaaaaaaaatgaagggtgaa
gcaatgaagtttcatcttttgatcttcatggtattcttagttaccctagcttctgctgct
tcatccccttcagtcatcattgttggagctggaatgtccggaatttctgcagcaaaggat
ttgcatgatcagggcgtcaaggatttcatctttttggaagcaacagatagaattggtggt
aggattcacaagaccgaattcgcagggcatgcggttgagatgggagcaaattggcttcac
ggtgtaggaggtcctcggaagaatcccatgtatgagatcgccaaggaaatcaagcttagg
tccttttactcggactggaacaatatatcatataactcctacaagcaagagggtggacgg
tattcgaaagaagaggtggacgcggcattagacatggctgagagtaatgaagactatgca
gaagagttatcagaaaggcttagtgctaagaaaggaaaagatgatgatatgtcccttttg
gcagctgaacgtctcaaccacagggagccaaaaacacccctagagaagatgattgacttc
tactctttcgacggtgagcaagcagagtcacctagggtaacaagtcttaagcatattatt
ccaaggccagagtatactctttttggtgagaatgactacttcgtggctgactctagaggg
ttcgagagcattgttcatcatattgcgaaaacttacctcacctacaccaatgatactctc
aatgaccctagagtcatctttaaccaggttgtgaaagaggttgattactcaaacagtgga
atagtaacagtaaaaacagaagatggcaatgagtacacagcccaagctgtaattctatca
ccaagtgttggtgttctccaaagtggtctcatctcttttaaaccagaattgcccttttgg
aaaaggcgcgccattgctgaatttagcttgggtatatacaccaagatcttccttaagttc
cctaagaagttctggcctaccggcaaaggaaccgagtttttcttttatgcccatgaaagg
cgtggatattatgcattttggcagcaattagaaatggagtatccaggatccaacattttg
atggttacggtaacagacgacgagtcgaagagagtagaggcacaaccagatgagaaaaca
aaagcagaagcaatggaagttctgcgcaaaatatttggagatgacattcctgatgctact
gaaattttgatcccaagatggtattctgatcggttttacaagggcactttctctaactgg
cctgttggatacactattaaaaagcataacaacctcaaggctccggttgaaaatgtcttc
ttcactggagagcatacacatgcgcaactctttggatatgcagatggcgcttattatgca
ggtaagagggccgcaaatgatgtcaacaagttgctcaagaaaaagaagtcaccaaatcta
agatctttatattattggtggatgtaa

DBGET integrated database retrieval system