KEGG   Chenopodium quinoa (quinoa): 110687279Help
Entry
110687279         CDS       T05764                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 10 isoform X1
Organism
cqi  Chenopodium quinoa (quinoa)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Stress-antifung Haspin_kinase APH Kdo ABC1
Motif
Other DBs
NCBI-GeneID: 110687279
NCBI-ProteinID: XP_021719600
Position
Unknown
AA seq 674 aa AA seqDB search
MAQKISWSSLFFSIYMPIIIVILCKSTSAQNYDCGSNTTIFVNNSQYEANLNTLFRYLLS
NATDPNGYHQAVSSNGNPNSEAIYGHFLCRGDLNASACQTCVDNVTATDLPMNCPNRKEA
IVWRDECMIRYSNQSFFGKMDTSPMRMLLNTLNVTGNSTRFEELRDNMMNNVIANRAPTG
GSLKKFATDFVNVTMSQTIYGLGQCTPDLAPSDCNTCLLNGIQQFKMTQGAHNFQPSCVV
QYEIYSFFDLSSVAPPPQPLPLPPRQSPTGGFSGLSSGNGSYTGKIAILVTVSTILLIVL
AIGFYLLFRRRKSWIKFGAASVFHRRDDSDESTSLVSLQFDFRTIKVATNNFSDDNKLGR
GGFGTVYKGRLANGQEVAVKRLAKDSGQGDEEFKTEVLLVAKLQHKNLVRLLGFCIERKE
RLLIYELLPNTSLDHFLFDVRKRSYLDWRSRYNIIVSIARGILYLHEESRLRIIHRDLKA
SNILLDAEMNPKIADFGTARLFEVDQTQGDTIRIVGTYAYMPPEYALHGLFSVKSDVYSF
GVLVLEIITGRKNRGSPNEQYAEDLINFVWRNWREGTPLKVVDPTLSIRSKTDIIRCIHM
GLLCVQENAEDRPTMSFIVLMLSSHSLTLPAPSCPAFVTSIAIRVDTKSHHHTKERTIGR
SSVNKDSITDPYPR
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaaaaataagttggtcttctttatttttctcaatctatatgccaattattata
gtgatactttgcaaatcaacaagtgctcaaaactatgactgcggctcaaacactacaatc
tttgtaaataatagccaatatgaagccaatctcaacaccctcttccgttatctcttatcg
aatgcaaccgacccaaacggctaccaccaagcggtttctagcaatggaaaccccaatagc
gaggctatttatggccacttcctttgtcgcggggatttaaacgctagcgcgtgccaaact
tgtgttgacaatgtcacggccactgaccttcctatgaattgtcctaatcgaaaagaagcg
attgtatggcgtgatgagtgtatgataaggtattcaaaccagtcattttttggtaaaatg
gacacgagcccaatgcggatgttgttgaatacgcttaatgtaacggggaattcaacccgg
ttcgaggagcttcgggataacatgatgaacaacgtgattgctaaccgagcccccactgga
ggatcactgaagaaattcgcgacagattttgtaaatgtaacgatgtcccaaactatatat
gggttgggtcagtgtacaccggacttggcccctagtgattgtaacacatgcttgctaaat
ggtattcagcagttcaagatgactcaaggtgcacacaatttccagcctagctgtgttgtc
caatacgagatttattctttctttgatttgtcatcagtcgccccaccaccccaaccgttg
ccactacctccacgacaatcgcccacgggtggtttcagcggcctatcaagtggaaacggg
agctacacggggaagattgccatcctagtcacagtatcaacaattctactgatagttctt
gcaattggattctatttattgtttagaagacgaaaatcatggataaaatttggagcggct
tctgttttccatcgtcgagatgacagtgatgaaagtacaagtttagtgtctctacaattt
gattttcgtacaataaaagtagcaacaaacaacttctcggatgataataaacttggccga
ggtggatttggtactgtatataaggggagattagcaaatggacaagaagtcgcggtgaaa
agactcgcaaaagattcaggacaaggtgacgaggagtttaagacagaggtgctgttagtg
gctaagcttcaacacaagaatctcgttaggctccttggattctgtatcgaacgtaaagag
agacttctcatctatgagttacttcccaatacgagccttgaccatttcttgtttgatgta
agaaagcgatcatatttggactggagaagccgctacaatattatagtgagtatagctcga
ggaatcctttaccttcatgaagaatctcgattgcgaatcatccatcgtgatcttaaggcc
agcaacatactacttgatgctgaaatgaatcctaaaattgcagattttggcacggcgagg
ttatttgaagttgaccaaactcaaggagataccatcagaattgttggtacctacgcatat
atgccaccggaatatgcacttcatggattattctctgtaaaatccgatgtctacagcttt
ggtgtactcgtgctcgaaattataactggtaggaagaatagaggttctcccaatgagcaa
tatgcagaggacctaataaactttgtatggcggaattggagagaaggtacacctttaaaa
gttgtggatccaactttgtcaataagatcaaagacggatattataagatgcatacacatg
ggcttattatgtgttcaagaaaatgcagaggaccgaccaacaatgtcctttatagtgttg
atgctcagtagccattcgcttactcttccggcgccttcctgtcctgcgttcgtcacgtcc
attgctattagagtggacactaagtcacatcatcataccaaggagagaacgattgggcgt
tcatcagtgaacaaggattcgattactgacccttatccacgataa

DBGET integrated database retrieval system