KEGG   Chenopodium quinoa (quinoa): 110687933Help
Entry
110687933         CDS       T05764                                 

Definition
(RefSeq) beta-amyrin synthase-like
  KO
K15813  beta-amyrin synthase [EC:5.4.99.39]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00909  Sesquiterpenoid and triterpenoid biosynthesis
cqi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    110687933
Enzymes [BR:cqi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.39  beta-amyrin synthase
     110687933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SQHop_cyclase_C SQHop_cyclase_N Prenyltrans
Motif
Other DBs
NCBI-GeneID: 110687933
NCBI-ProteinID: XP_021720272
Position
Unknown
AA seq 758 aa AA seqDB search
MWRLKIAQGANEPYLFTTNNFMGRQTWEFDPNYGTPEEREEVEEARRNDYEKRFQDKACG
DLMWRLQFLREKNFKQTIPQMKVGDGEEITYETASTTIKRAASYLIALQAEDGHWPAQAS
FPQFYLPPLVFCLNITGHLNSTFSTQHQTEIFRSIYNHQNEDGGWGFHCEGHSTMFCTAL
NYICLRILGVGPDEGDDNACPRARKWILDHGSITHIPSWGKIWLSVIGLYDWSGCNPIPP
ELLLFPSAFPMHIGKMWCYIRMVFMPVSYLYGKRFVGPITPLIMQLREELYKEPYNQISW
SKARHACAMEDLYYPHPLIQDLFWVTLHYFVEPLLTRWPLNKLFREKALEVTMKHIHYED
ENSRYITLAIVEKVLCMMACWVEDPNGDYFKKHLARIPDYIWISEDGLKVHGIGSQQWDC
GLSVQALVASNLGLDEIGPALKKAHFYIKESQIKDNPSGDFKSMYRHISKGAWAFSDRDQ
GWQVSDCTADSLKCCLILSTIPSEIVGEKMDIERIFDSVNFLLSLQSKNGGVTGWEPARG
QKWLEILNPTDLFANVVVEHEYVECTSSTIQALVLFKNIYPSHRKNEIETFITKATEFIE
NSQCPNGSWYGSWGNCFTYGTYLSLRGLVAAGKRYDNCVAIRKGVEFLLATQKIDGGWGE
SYLSCTKEEFVPLEGNSNVVQTAWALMGLLHAGQAKRDPIPLHRAARLMINSQLENGDFP
QQESTGTSLKNCILHYPMYRNYYPLLALAQYRKLVPLP
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgtggaggttgaagatagcacaaggggcaaatgagccttacttatttactaccaacaac
tttatggggcgtcaaacttgggagtttgatcccaactatggcacccccgaagaaagagag
gaagttgaagaagctcgtcgtaacgactatgaaaaacgctttcaagacaaggcttgtggt
gatcttatgtggcgtcttcagttcctaagagagaaaaacttcaagcaaacgatacctcaa
atgaaggtaggtgatggggaggagatcacatacgagaccgcctcgacgaccataaagaga
gctgctagttacctcatagctttgcaagctgaagatggccattggccagctcaagcttct
tttcctcaattttacctccctcctttggtattttgcttaaacataacaggacatctaaat
tctactttctcaactcaacaccaaactgaaatttttcggagcatttacaatcatcagaat
gaagatggaggttggggatttcattgtgaaggacatagcaccatgttttgtaccgcgctc
aactacatttgtttgcggatacttggtgtaggacctgatgaaggtgatgacaacgcgtgc
cctagagctcgtaaatggatacttgaccatggtagtattacacatattccttcttgggga
aaaatttggctctctgtaattggtttgtatgattggtcgggatgtaatccgattccacct
gagttattgctctttccatccgcttttccaatgcatataggtaaaatgtggtgctacatt
cgaatggtatttatgccagtgtcttatttgtatgggaaaagatttgtgggtccaattaca
ccactaattatgcagcttagagaagaactctacaaggaaccttataaccaaattagttgg
agtaaagctcgtcatgcatgtgctatggaagatctctattaccctcacccattgatccaa
gatttgttttgggtcactcttcattactttgtggagcctttacttactcgatggccccta
aacaagttgtttcgagagaaagctttggaggttactatgaagcacatacattacgaagac
gaaaatagtcgttacataacacttgcaattgttgaaaaggtgctatgtatgatggcatgt
tgggtggaagatcccaacggagattattttaagaaacatcttgctagaattcctgattat
atttggatatctgaggacggattaaaagtgcatggaattgggagccaacaatgggattgt
ggattatccgtccaagcattggtagcttcaaatctaggtcttgatgaaattggacccgct
ttgaagaaagctcatttctacatcaaagagtcacagataaaggacaatccatcgggagat
ttcaagagtatgtatcgacacatctcgaaaggagcttgggctttctctgatcgagatcaa
ggttggcaagtttctgattgcaccgctgatagccttaagtgttgcttaatcttatcaaca
attccctcggagattgttggagaaaagatggacattgagcgtatatttgactccgtcaat
tttttgctttctttacagagtaaaaatggaggggttactggttgggagccggcgagaggt
caaaaatggttagagatcttaaatcctacggatttatttgccaacgttgttgtcgagcac
gagtacgtggagtgtacaagttcgacaattcaagctctagtattgttcaagaatatatac
ccaagccataggaagaacgagattgaaactttcatcacaaaggcaaccgaattcattgag
aactctcaatgccctaatggatcttggtatggaagttgggggaattgctttacatatggg
acatatttgtctcttagagggctagtagcagcaggaaagagatacgataattgtgtagcc
ataagaaagggtgttgaatttcttctcgcaacacaaaagatagatggtggctggggtgag
agctacctttcatgtaccaaggaggaatttgtgccactagaaggaaactccaatgtggtc
cagactgcatgggctttgatgggtctactccatgctggtcaggcgaagagggaccctatt
cctctacatcgggcagcaagacttatgatcaattcacaactagaaaatggtgattttcca
caacaggaatcaacgggaacatccttgaagaattgcattttacattatccaatgtacagg
aattattatccattgttggcacttgctcaatatagaaagcttgttccattaccttga

DBGET integrated database retrieval system