KEGG   Chenopodium quinoa (quinoa): 110690857Help
Entry
110690857         CDS       T05764                                 

Definition
(RefSeq) putative glucose-6-phosphate 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00010  Glycolysis / Gluconeogenesis
cqi01100  Metabolic pathways
cqi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110690857
Enzymes [BR:cqi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     110690857
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 110690857
NCBI-ProteinID: XP_021723435
Position
Unknown
AA seq 320 aa AA seqDB search
MASSSSDPKIPPLLPVEFTKASNGLDKVILREASGVSAEVYLYGAHVTSWKNENREELLF
VSSKAIFKPPKPIRGGIPICFPQFSNHGMLEAHGFARNRVWKVDPESQPSPANTANKSYV
DLLLKPSEDDLKIWPHIFEFRLRVTLAPGGDLMLTSRVRNTDTKPFNFSFAYHTYFSVSD
ISEVRVEGLETLDYLDNTKGRERFTEQGDAITFEGEIDKIYLSTPSKIAILDHERKRTFV
IRKDGLPDAVVWNPWNKKAKALADFGDDEYKHMLCVEPAAIEKQITLKPGEEWRGRQELS
AVPSSYCSGQLDPLRVLRGS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcttcaagcgaccccaaaattcctcctcttcttccagtcgagttcaccaaa
gcctccaatggccttgacaaggtcattcttcgcgaagctagtggcgtctctgccgaggtt
tacctctatggagctcatgtcacttcttggaagaatgagaatagggaggaattacttttc
gtaagcagcaaggctatctttaagccccccaaaccaattcgtggaggcatacctatatgt
ttccctcagttcagcaatcatggaatgcttgaagctcatggatttgccagaaatagagtt
tggaaagttgatcctgaatcacaaccttctcctgcaaacacagctaacaagtcttacgtt
gatttgctgctgaaaccttctgaagatgatctgaagatttggcctcacatttttgaattt
cgtctgagagtaaccttggcccctggaggagatctgatgctgacatcacgagttagaaac
actgatacaaagccattcaacttttcatttgcttatcacacctatttctctgtttctgat
atcagtgaagtccgggtagaaggattggagactttggattaccttgacaacacgaagggc
agggagcgctttactgaacagggggatgccatcacatttgaaggagaaattgacaagata
tatctaagcacaccctctaagattgcaatcctggatcatgaaaggaaaaggacattcgtg
attcgtaaagatggactaccagatgctgtggtatggaatccctggaacaagaaagctaag
gcattggctgattttggagatgatgagtacaagcatatgctgtgtgtggaacctgctgca
attgagaagcagataacgctcaagccgggtgaggagtggagaggcaggcaggaactatct
gccgttccatctagctattgtagcgggcagcttgatcctctgagagttctacgaggaagc
tga

DBGET integrated database retrieval system