KEGG   Chenopodium quinoa (quinoa): 110693173Help
Entry
110693173         CDS       T05764                                 

Definition
(RefSeq) probable sesquiterpene synthase
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
cqi  Chenopodium quinoa (quinoa)
Pathway
cqi00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    110693173
Enzymes [BR:cqi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     110693173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth ANTAR
Motif
Other DBs
NCBI-GeneID: 110693173
NCBI-ProteinID: XP_021725990
Position
Unknown
AA seq 547 aa AA seqDB search
MSAQTHRPIANFHPCHWGDHFLNITNPHHDEAVQVQKEQEVSQLKDEVKKELLETKSNPL
ELLNFIDVIERLGLAYHFEQEVEDALKQIYESYEEQCAKDDLYHISTRFRILRQHGFFVP
CDVFNKFKDENGSFKESITKDVPGLLSLYEASHVRVHDDKILDEALAFSTTRLNAMVNQL
SSPLADQVSHALHQPLHKGMPRVETRHFISVYEMDPSHNKTLLKFAKLDFNLLQALHQKE
LKDLKRWWKGLHLNASFSRDRLTEAYFWILGVYYEPQFSFARKVYRKIFKSTSLLDDTYD
AYGTIEELELLTETFQRAWDKSCMDELPEHVKWSYYANVEACEEAEKDLAKEGRSSFVNY
TRQQLKALCKAYIQEARWCHQKYVPTYDEYMKIALVTSPYPHGIVASFLGMGEIASKEVF
EWACQTPMPNIIKAASTIIRLMNDIGGHKFEQNRKHVASAVQCLMEKHAYSEEEANEKLK
EEVEHAWKDINQAMLLPYVIPKPLLTRILNLARAADVIYKGDADGYTHVNQTLKDKVASV
LSHPIPM
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctcaaacacatcgtcctattgctaactttcatccatgtcattggggtgatcac
tttcttaatatcacaaaccctcatcatgacgaggcagtccaagttcaaaaggagcaagaa
gtgagtcaacttaaagatgaagtgaagaaggagctgctggaaactaagagcaaccctctt
gagctgctgaatttcatcgacgtgatcgaacgtcttggattggcatatcactttgaacaa
gaggttgaggatgctttgaagcaaatttacgagagctatgaagagcagtgtgccaaagat
gatctttaccatatttcgactcgatttcgtatcctcaggcaacatggcttctttgtgcct
tgtgacgtgtttaacaagttcaaagatgaaaatggaagcttcaaggagtcgataaccaag
gacgttccaggattgttaagcttgtatgaggcttcccatgttcgagttcacgatgacaag
atactcgacgaagcccttgcattttcgacaactcgtctcaatgccatggttaaccaatta
agctcacctcttgcggatcaagtttcccatgcccttcatcaacctctccacaaggggatg
ccgcgagtagagactaggcatttcatctcggtgtatgaaatggatccttcacataacaaa
actctcctcaagtttgcaaaacttgatttcaatttgcttcaagccttacaccagaaggaa
ctcaaagatctaaaaaggtggtggaaaggactacatttgaatgcatcattcagtagagac
cgattgacggaggcgtatttttggattttaggagtgtactatgaaccccaattttcattt
gctcggaaagtgtatcgaaaaattttcaagtcaacatcattattagacgatacgtatgat
gcatatggaactattgaagaacttgaacttctcactgaaacatttcaaagggcatgggac
aaaagttgtatggatgaacttccggagcatgtgaagtggagttattatgccaatgttgaa
gcttgtgaagaagctgaaaaagatcttgccaaagaaggaagatcatctttcgtcaactat
acaagacaacagttgaaagccttatgcaaagcctatattcaagaagcaagatggtgccac
caaaaatatgtccctacatatgatgagtatatgaagattgccttggtgacctctccttac
cctcatggaatagttgcctcatttcttggcatgggagaaattgcttcgaaggaggtattt
gaatgggcatgtcaaactcctatgcctaatatcataaaggctgcatctacaataataaga
ctcatgaatgacataggtggccacaagtttgagcaaaacaggaagcatgtcgcatcagct
gtgcaatgcttgatggagaaacatgcgtattctgaggaggaagcaaatgagaagctaaaa
gaagaagttgagcatgcttggaaagatattaatcaagcaatgcttctaccttatgtgatt
ccaaaacctttacttacgcggattctcaacttagctcgcgctgctgatgttatatacaag
ggcgatgctgatggttacacacatgttaaccaaactcttaaggacaaagttgcatctgtt
ctttctcatcctattcccatgtaa

DBGET integrated database retrieval system