KEGG   Chenopodium quinoa (quinoa): 110693246Help
Entry
110693246         CDS       T05764                                 

Definition
(RefSeq) L-type lectin-domain containing receptor kinase IX.1-like
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
Enzymes [BR:cqi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110693246
Protein kinases [BR:cqi01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110693246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_legB Pkinase Pkinase_Tyr SKG6 Pkinase_fungal Lectin_leg-like Kinase-like PIP49_C
Motif
Other DBs
NCBI-GeneID: 110693246
NCBI-ProteinID: XP_021726093
Position
Unknown
AA seq 718 aa AA seqDB search
MRVSICSVSSSLYFIQKTCNIFHMFILLFFIVSNVQSLSFSFPTFNQNTQKIILGNDTTL
TNKAIQLTANRIDGSLHGSVGRASYKQAVRLWDKSTNKTTNFTTHFSFNITQADKNPNYY
GDGLAFFLAPFYVSADAPEESSGGCLGLIGGASKSCNVTSTYPFVAVEFDSYHNKWDPGF
SWDPSNDHVGINVNSVYSKANFTVTDGLKNRSTANAWITYDSSTRNLSVYLSYDANPVFD
GESSLSYVIDLRSVLPERVRVGFASATGANYELHNILSWDFNSTLEDIDISVTPPPQNYT
SNQASTRPSKKNSKAAVVGGSVAGISVTIIGLGAVAFMWWRRKSGGNNDDINFEMDDDYD
QDTGPRRLTYSELIRATNNFPEEGKLGQGGFGGVYRGYLSDLSRDIAVKKISRGSKQGKK
EYVSEVKIISRLRHRNLVQLLGWCHELGDLLLVYEYMPNGSLDSHLYGDRREVVLPWTER
YRIAHGLASSLLYLHEEWEQCVLHRDIKASNVMLDSNFNAKLGDFGLARLVDHNRGSQTT
VLAGTLGYLAPECVMAGKYSKESDVYSFGVVALEIACGRRPVETNEEPSKVNMIEWVWQL
YGEVHLLEAADKRLDAKFDSQKMECLMIVGLWCCHPEYTFRPTIRQVINVLNMESSLPNL
PMKFPVPFYSSLPTNVEPFYISSSSGFTGSSTAGTTTSSSSHSVVSGTVPLLLENATV
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgagggtatcaatttgcagcgtcagttcgtcattatacttcatccaaaagacttgtaat
atctttcatatgtttattttgctgttttttattgtctcaaatgtacaatcattgagcttt
agcttccctacttttaaccaaaacactcaaaaaattatcttagggaacgatacaactctt
acaaataaggcgattcaactgactgccaatagaatagatggcagtctccatggcagtgta
ggacgggcatcctacaaacaggctgtgcgcctttgggataaaagcacaaacaagacaaca
aactttaccacccacttctcttttaacattacacaggcggataagaatcctaactactac
ggtgatggactcgccttttttctagcaccgttctatgtttcagctgatgctccagaggag
tcatctggtgggtgtcttggtttgataggtggtgctagtaaatcttgcaatgttacgagt
acatacccctttgttgctgtcgagtttgatagctaccacaataaatgggatccaggtttt
tcatgggatccgagtaatgatcatgtaggaataaatgtcaattctgtatattcaaaagca
aattttacagtaactgatggcctgaagaacaggagtacagcaaatgcatggataacttat
gattcttctaccagaaatctaagtgtttacttaagctatgatgctaatcctgtatttgat
ggggaatctagcctttcatatgtcattgacctgagatcagttctcccggaaagagtcaga
gttgggtttgcttctgcaacaggggcaaattacgaacttcataacatcctttcttgggat
ttcaactcaaccttagaagatatcgatattagtgtaacgccacctccacaaaattacaca
agcaatcaagcatcaactaggccaagcaaaaaaaatagcaaagcagcagtggttggtggt
tctgtagccggtattagtgtcaccattattggattaggtgcagtagcatttatgtggtgg
cgaaggaagtccggaggaaataacgacgacataaactttgaaatggatgatgattatgat
caggataccgggccgaggaggctcacttacagtgaacttattcgcgctactaacaacttc
cccgaggaagggaagttaggacagggaggttttggaggtgtgtatagaggttatctgtct
gatctcagtcgggatattgcagtcaagaaaatatcaaggggatctaaacaagggaaaaag
gagtatgtgtcagaggtgaagattatcagtcgattgaggcatagaaatttggttcagctt
cttggttggtgccatgaactaggagatttgcttcttgtttatgaatatatgcctaatgga
agtcttgactctcatctttacggggacaggagggaggtggtcttaccttggacagagagg
tacagaattgctcatggcctggcatcttccttgttatacctccacgaagaatgggaacaa
tgtgtgctgcatagagatatcaaggccagcaatgtcatgcttgattctaatttcaatgct
aagcttggagattttgggcttgctaggcttgtggaccacaatcgaggatcacaaacaact
gtattggccggcactttaggctacctagccccagaatgtgttatggcaggtaagtacagc
aaagaatctgacgtatacagttttggagtggtggcccttgaaattgcttgtggaagacgg
cctgttgaaaccaatgaagagcctagtaaggtgaatatgatagagtgggtgtggcagctc
tatggagaagttcatcttcttgaagcagccgataaaagacttgatgccaaatttgacagt
cagaaaatggaatgcttaatgattgttgggttgtggtgttgccatcctgaatatactttc
cgtcccactataagacaggttataaatgttcttaacatggaatcttctttgcctaatttg
cctatgaagttcccggttcccttctacagttctctgccaactaatgtagagcctttttac
atctcgtcctcctctgggtttacaggcagcagtactgctggcaccacaacctcctcatca
tctcactcagttgtttccggtactgttcctttgctgttagagaatgcaacagtttga

DBGET integrated database retrieval system