KEGG   Chenopodium quinoa (quinoa): 110693425Help
Entry
110693425         CDS       T05764                                 

Definition
(RefSeq) putative receptor-like protein kinase At4g00960
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
cqi  Chenopodium quinoa (quinoa)
Brite
KEGG Orthology (KO) [BR:cqi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cqi01001]
    110693425
Enzymes [BR:cqi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110693425
Protein kinases [BR:cqi01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110693425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Stress-antifung APH SKG6 DUF3403 Pkinase_fungal Mid2 TMEM154 DUF4448 DUF3377 TMEM51
Motif
Other DBs
NCBI-GeneID: 110693425
NCBI-ProteinID: XP_021726235
Position
Unknown
AA seq 667 aa AA seqDB search
MKLTKLFFLVFLVQLFYVIPKTSAQLFEFLYNLCGENHSTPNAYLTNLKTTLNSMSSNTQ
ITYGYYNFTAGQQPNKVEAMALCRADISVDDCRDCVSSSASSLLSVCPNSMKAFGYSDNC
VIYYTNISLFHVLTDRPFWALRFDGRITADIPKFNSSLTTLMTSLQNKASLGNSVLKFAT
GNTKVTANQSLYGLVQCSPDLNRLDCVKCVQNLTLSVFTQYFITTSPLYMAKGGRVVSAS
CNLRYELYPFYKNVTYIATPPASNRNATTSIQGASSSKSHKIIAIVVPIVGSLVLILIIA
SFCIFVRRKKQIKFSGNFDKEEMDTLQSLQFSTGAIKVATENFAVENVLGKGGSATVYKG
KLTDGQEIAVKRIERHAVLGEEQFKNEILTLAKLHHGNLVRLLGFCLEEDEMLLIYEFVV
NKSLDAFLFDPEHRASMHWDTRLDIINGVARGLLYLHEDSQQRIIHRDLKAANVLLDADF
IPKIADFGLAKLFKADQSQAVASKVVGTHGYMPPEYLIQGQVSLKSDVFSFGVLVLEIVS
GQKISSFQIGEKQESLLAYAWENWQEGKAWNLVDPALSPAFSAEILRCIHIGLLCVQNNM
ADRPTMSSVSLMLSSNTMTLEAPLQPAFFKQNRPMLLSEPSQDNSSDQSNSRSLSVNEAS
VTELYPR
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaccaaattattcttcttagtatttttggttcaactattttatgtcattccc
aaaacttctgctcaattatttgagtttctctataatttgtgtggagaaaatcactccact
cccaatgcttatctaacaaaccttaaaacaaccctcaattctatgtcttcaaacacccaa
atcacctatggttactataacttcaccgccggtcaacaacccaacaaagtcgaagccatg
gctctctgcagggccgatatctcagtcgatgattgtcgtgattgtgtcagttcttctgct
tctagtctgctttcagtctgtcccaacagtatgaaggcgttcgggtattctgacaactgt
gtaatatattacacaaacatcagtctgtttcatgttttaacagataggccattttgggct
cttcggtttgatggcagaattactgctgatatccccaagtttaacagttcgcttactact
ttgatgacctctttgcaaaacaaggcttccttaggtaattctgttcttaaatttgctacc
ggaaacacgaaagttactgccaatcaatccttgtatggtcttgttcagtgtagtcctgac
ttgaataggctcgactgtgttaagtgtgtgcaaaatctcactttgagtgtcttcacacag
tattttatcaccactagtcctttatatatggctaaaggaggaagagtggtttcggctagt
tgcaatcttcggtatgagctctatcctttctataagaatgtaacttacatagctactcca
cctgcctccaacagaaatgccactacttctattcaaggtgcaagtagtagcaaatcacat
aaaatcattgctatcgttgttccgattgttggatcattagtactcatccttatcatagct
tccttctgtatctttgtacgaaggaagaagcagataaagttttcaggaaattttgacaag
gaagaaatggacactcttcaatccttacaattcagtactggggcaatcaaggttgcaaca
gagaactttgctgttgaaaatgtgctcggaaaaggtggatccgccactgtttacaaggga
aagctgactgatgggcaagaaatagcggtgaagaggatcgaacgacatgcagttctaggg
gaagagcagttcaaaaatgaaattctgaccctagcaaagctgcatcacgggaatctagtg
agacttctcggattctgcttggaagaagatgaaatgcttctcatttatgagtttgtcgtc
aataaaagccttgacgcctttctttttgacccagagcaccgtgcatctatgcactgggat
acgcggcttgacattattaatggcgttgctagaggactcctatacctgcatgaagattca
caacagcggattatacaccgtgacttgaaagctgctaatgttctgctagacgctgatttc
atccctaagattgcagattttggcctagcaaagttgttcaaggctgaccaatctcaagca
gtggcaagcaaagtagttggtactcacggatacatgccaccggagtatttgatccaaggt
caggtgtcattgaagtcggatgtgtttagctttggtgtacttgttttggagatagtaagc
ggccaaaagattagctctttccaaattggagaaaaacaggaaagtctgcttgcttatgca
tgggaaaactggcaagaaggcaaagcgtggaatcttgtagaccctgcactatcccctgct
tttagtgctgagatactgagatgcatacacatcggtttgctatgtgttcagaataacatg
gccgatagaccaactatgtcttcagtatctcttatgctaagtagcaacactatgaccctg
gaagcgcctttgcaaccagcatttttcaaacaaaaccgtcccatgctactaagtgaacct
tcacaagacaattcctcagatcaatcaaatagcagatcattatcagttaatgaagcttct
gtgacagagctctaccctcgataa

DBGET integrated database retrieval system